Report for Sequence Feature Glyma07g31530
Feature Type: gene_model
Chromosome: Gm07
Start: 36530779
stop: 36534329
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g31530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G21720 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 2692 Blast hits to 975 proteins in 186 species: Archae - 4; Bacteria - 460; Metazoa - 658; Fungi - 93; Plants - 1089; Viruses - 100; Other Eukaryotes - 288 (source: NCBI BLink). | chr4:11542561-11544274 FORWARD LENGTH=139
SoyBase E_val: 2.00E-50 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6T0T9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0T9_SOYBN
SoyBase E_val: 2.00E-95 ISS
Expression Patterns of Glyma07g31530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g31530
Paralog Evidence Comments
Glyma13g24910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g31530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g195600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g31530
Coding sequences of Glyma07g31530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g31530.1 sequence type=CDS gene model=Glyma07g31530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATGTCGCAGCAATGGGGCTCTCCATGTGGAAGCCAATGCACCAATAAATACGCTGCCCTCGGCAAAATCCCATGGCGAATATTCTGCAAAAAGGGTTGCGACTCAGATGGAGAGACATGGGAAGAATGTTTGGAGGACTGCAATCAAATATGCTACAAGGATCCCGTACTAAAGGACCAGCAGTGGAGTGCTTATATTGATCGTTCCCCTGGAGCTGCCAGTTATTCGGAGGAATGCTTTCATGCGTGTGTATCTGGCTGCGGTTACAAGTTTGAGGTTAAATCAGAGGAAGCTGATAAAGTCTGTCCTAACAGGCAACCAAAGCCTGAGACCAAGCCTACTAAGAAGCCAAAGCCACAACCTGTACGCCCCATCGATCTGCCTGGTGATATACCTGACACTTCTGCATAG
Predicted protein sequences of Glyma07g31530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g31530.1 sequence type=predicted peptide gene model=Glyma07g31530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MMSQQWGSPCGSQCTNKYAALGKIPWRIFCKKGCDSDGETWEECLEDCNQICYKDPVLKDQQWSAYIDRSPGAASYSEECFHACVSGCGYKFEVKSEEADKVCPNRQPKPETKPTKKPKPQPVRPIDLPGDIPDTSA*