SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g31000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g31000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g31000

Feature Type:gene_model
Chromosome:Gm07
Start:35969085
stop:35970953
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11240AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Nucleolar protein 12 (InterPro:IPR019186); Has 2484 Blast hits to 1934 proteins in 262 species: Archae - 0; Bacteria - 90; Metazoa - 921; Fungi - 378; Plants - 144; Viruses - 18; Other Eukaryotes - 933 (source: NCBI BLink). | chr1:3766936-3768212 REVERSE LENGTH=200 SoyBaseE_val: 9.00E-21ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0006302GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0042991GO-bp Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR14577Panther UNCHARACTERIZED JGI ISS
PF09805PFAM Nucleolar protein 12 (25kDa) JGI ISS
UniRef100_I1KLE0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLE0_SOYBN SoyBaseE_val: 5.00E-124ISS
UniRef100_Q10LE2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10LE2_ORYSJ SoyBaseE_val: 6.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g31000 not represented in the dataset

Glyma07g31000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g06310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g190800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g31000.1   sequence type=CDS   gene model=Glyma07g31000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCGCAGCGCAAAGGCGCGCAGCTGAAGAAGAGGGCTCTGAAGAACAAAGCTTTGGGCATCACCTTCAACGAGAAAGATCTCAATGACTATGTCACCGGCTTTCACAAGCGCAAGAAGAAGAGAAGAAAGGAAGCCCAGAAGCAACAGAACGAGGCTCTGCGCCGCAAACGCAACGACGAACGCAAAAGGAGGAAGTTGGAAAGAGAACATGTTCTTAATGGAGGCGTGCCACCTGATGAAATTGATGAGGGCCAAGAAGAAGTTGAGGAGCAAGTTGAATCTATTGCTGAAATGAAGACATACGAGAATGATGATCTGAAAGTCACTGTTGTAACAAGTGAGATCAACCCTGAAGACGAAAGTTATCCTAGTGAGAGGAAGGAGGCAGCAGTGATCCCTCAATCTGTTGTGTCTGATAAAAGGCAAGGGGTACCCATAAGTAACAAGAAATCTTTCAAGAAGGTTGCAAAACAGAGGTCTCGGCCAAGGCCATCAAGTAAGAGAGATAAAAAGAAAGGAAAGAAGCGAGGCAAGAAGTAA

>Glyma07g31000.1   sequence type=predicted peptide   gene model=Glyma07g31000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAQRKGAQLKKRALKNKALGITFNEKDLNDYVTGFHKRKKKRRKEAQKQQNEALRRKRNDERKRRKLEREHVLNGGVPPDEIDEGQEEVEEQVESIAEMKTYENDDLKVTVVTSEINPEDESYPSERKEAAVIPQSVVSDKRQGVPISNKKSFKKVAKQRSRPRPSSKRDKKKGKKRGKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo