SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g30630

Feature Type:gene_model
Chromosome:Gm07
Start:35581931
stop:35584311
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g30630
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21320AT Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein | chr4:11340492-11341732 FORWARD LENGTH=286 SoyBaseE_val: 5.00E-142ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0019295GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme M biosynthetic process SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
PTHR10795Panther SUBTILISIN/KEXIN-RELATED SERINE PROTEASE JGI ISS
PTHR10795:SF3Panther SUBTILISIN-RELATED SERINE PROTEASE JGI ISS
PF02679PFAM (2R)-phospho-3-sulfolactate synthase (ComA) JGI ISS
UniRef100_Q8GWL1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aldolase-type TIM barrel family protein n=1 Tax=Arabidopsis thaliana RepID=Q8GWL1_ARATH SoyBaseE_val: 2.00E-139ISS
UniRef100_UPI0002337EC2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337EC2 related cluster n=1 Tax=unknown RepID=UPI0002337EC2 SoyBaseE_val: 0ISS

Expression Patterns of Glyma07g30630
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g30630
ParalogEvidenceComments
Glyma08g06660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g30630 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g186900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g30630
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g30630
>Glyma07g30630.1   sequence type=CDS   gene model=Glyma07g30630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCCGATGGAAGTGCTTCGAGGAGAACGAGGATCGCCCCGCCAAGCCTCGTTGCTTTGGCGTCACCGAGATTCGAAGACCCCACTACACTCTCTTCTCCCACAACCTTCTTCAGGATATTTTTGAATCTGTGGGAGACTATGTTGATGGGTTGAAGTTTTCTGGAGGTTCTCACAGCATGATGCCAAAGGCTACTATCAAGCAAGCCATTGACATGGCCCATCAGCATGACGTGTACGTTAGCACGGGTGATTGGGCTGAGCACATGGTTAGCAAAAGTCCATCAAGTTTCAAAGAATATGTAGAGGAATACAAGCAGTTGGGGTTTGACACAATTGAGCTCAATGTGAGTTCGCTTGAGATTCCTGAAGAGACCTTTTTGAGATTTATCCGCTTGGTCAAAAGTGGTGGTCTTAAAGCTAAGCCTCATTTTCAAGTGAAGTTTAATGATTTTTCCGCAGAATTTGTAGAAGATGTGAATCTCTTGATCAGAAGGGCCGAGAGATGTATAGAAGCAGGTGCAGACATGATAATGATTGATGCTGATGATGTTAGCAAACATGCAGATAACATGCGTGCGGATATCATTGCCAAGATCATAGGGCGCCTTGGTATTGAGAAGACTATGTTTGAAGCATCAAATCAGAGAATATCCGAGTGGTTCATCAAACAATATGGTCCAAATGTGAACCTCTTTATTGATCATTGGAACGTGGTGGATGTGGAGTGCCTCAGGGGACGCAACTTGGGTAAAAATCTTGCTTCTGTCCTTGGTTCTTCAGATTTCCTGTTCTGA
Predicted protein sequences of Glyma07g30630
>Glyma07g30630.1   sequence type=predicted peptide   gene model=Glyma07g30630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FRWKCFEENEDRPAKPRCFGVTEIRRPHYTLFSHNLLQDIFESVGDYVDGLKFSGGSHSMMPKATIKQAIDMAHQHDVYVSTGDWAEHMVSKSPSSFKEYVEEYKQLGFDTIELNVSSLEIPEETFLRFIRLVKSGGLKAKPHFQVKFNDFSAEFVEDVNLLIRRAERCIEAGADMIMIDADDVSKHADNMRADIIAKIIGRLGIEKTMFEASNQRISEWFIKQYGPNVNLFIDHWNVVDVECLRGRNLGKNLASVLGSSDFLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo