SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g30550

Feature Type:gene_model
Chromosome:Gm07
Start:35525625
stop:35526661
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g30550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48380AT Annotation by Michelle Graham. TAIR10: BAK1-interacting receptor-like kinase 1 | chr5:19604584-19606532 REVERSE LENGTH=620 SoyBaseE_val: 8.00E-41ISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0060548GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cell death SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0033612GO-mf Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding SoyBaseN/AISS
KOG1187 KOG Serine/threonine protein kinase JGI ISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_G7JSZ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: LRR receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7JSZ4_MEDTR SoyBaseE_val: 1.00E-76ISS
UniRef100_I1KL99UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KL99_SOYBN SoyBaseE_val: 4.00E-115ISS

Expression Patterns of Glyma07g30550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g30550
ParalogEvidenceComments
Glyma08g06741 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g30550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g186500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g30550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g30550
>Glyma07g30550.2   sequence type=CDS   gene model=Glyma07g30550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTCCACAATGAAGTTCAACGAAGTCAGTGATGCAACCGATTGCTTTTCTCCAGATAATAGAAGGCTACCAAATGGTTGGAACCTTGTAGTCAAGAGACTATTGGATGTTAAACAATTTAAGAGGGAATTTCTTTTGGAAATAAGGATTCTGAGTAAGCACAGAAACAGAAATATAGTTCCCCTGCTTGGGTTCTACATAGAAAGAAATGAAAGGATTTTGGTATACCAATACCTGTCAAATGGAAGGCTTTCTAAATGGTTACGTCCCACTTGGGTGGCAAGAGGCTTATCCTGGTTCCACTATATATGCAATTTGCATGTTGTGCATCTTAATATAAGTGCAGAGTGTGTCTTGCTAGATAAGAATTTTGAACCCAAAATATCCAATTTTGGAAAGGCAAAGTTTATGCATCCCAACATGTTGGGTAGGTCATCCTCTTATGAACCAATTTTTAAGGAGACCTTTCGAATGTCTTTGTTTCATTCTAACATCCTATCAAAACTAGAATCTCACATCGAATGGTTAACGAGAAAAACATTTAAGGAGTTGTCGTGTTCAACATCCAATGCTAGTAACCTATCTGGCAACTCTCGTAATTTTCTTAATGCAATTGAGGTATCTCTCATTGGGGAAGGTTTTGAAAATAAGGTCTACACTCTCATCAAAGTTGCATGTAGCTGCGTTCAGCCTTTCCCAGATCAAAGGCCAACGATGCTTCAAGTTTATAACTATATGATCGATATATGGGGGGAACGACATTGA
Predicted protein sequences of Glyma07g30550
>Glyma07g30550.2   sequence type=predicted peptide   gene model=Glyma07g30550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSTMKFNEVSDATDCFSPDNRRLPNGWNLVVKRLLDVKQFKREFLLEIRILSKHRNRNIVPLLGFYIERNERILVYQYLSNGRLSKWLRPTWVARGLSWFHYICNLHVVHLNISAECVLLDKNFEPKISNFGKAKFMHPNMLGRSSSYEPIFKETFRMSLFHSNILSKLESHIEWLTRKTFKELSCSTSNASNLSGNSRNFLNAIEVSLIGEGFENKVYTLIKVACSCVQPFPDQRPTMLQVYNYMIDIWGERH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo