SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g29720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g29720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g29720

Feature Type:gene_model
Chromosome:Gm07
Start:34800210
stop:34802917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g29720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23535AT Annotation by Michelle Graham. TAIR10: KOW domain-containing protein | chr5:7935871-7937127 FORWARD LENGTH=159 SoyBaseE_val: 6.00E-96ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR12903Panther MITOCHONDRIAL RIBOSOMAL PROTEIN L24 JGI ISS
PF00467PFAM KOW motif JGI ISS
UniRef100_B5AJV4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L24 n=1 Tax=Cucumis melo var. cantalupensis RepID=B5AJV4_CUCMN SoyBaseE_val: 2.00E-99ISS
UniRef100_C6SX56UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX56_SOYBN SoyBaseE_val: 3.00E-109ISS

Expression Patterns of Glyma07g29720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g29720 not represented in the dataset
Glyma07g29720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g180400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g29720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g29720
>Glyma07g29720.1   sequence type=CDS   gene model=Glyma07g29720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTGGAAAGCAGCTGAGAAACTCATTAGGCACTGGAAAGTTCTCAGAGGGGATAATGTTATGATAATAAGGGGTAAAGATAAGGGAGAGACTGGGAATATTAAGCGTGTCATTCGCACTCAGAATCGTGTCATTGTTGAGGGTAAAAATCTGGTGAAAAAGCATATCAAGCAAGGGCAAGGTCACGAAGGGGGCATCTTTACTGTTGAAGCTCCAATCCATGCCTCCAATGTGCAAGTTATTGACCCAGTGACAAGGAAGCCTTGCAAGGTTGGAACTAAATATCTTGAAGATGGTTCTAAAGTCAGAGTATCCAGAGGAATAGGAGCATCTGGATCCATAATCCCTCGACCTGAGATCTTAAAGATAAGAACTACCCCACGACCTACTGTGCTTGGTCCTAAAGATACTCCAATGGATCTTGTGTTAGAGAAGACTTATGATGCTAAAACAGGAAGGGGCATGCCTGAGCTTTAA
Predicted protein sequences of Glyma07g29720
>Glyma07g29720.1   sequence type=predicted peptide   gene model=Glyma07g29720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGWKAAEKLIRHWKVLRGDNVMIIRGKDKGETGNIKRVIRTQNRVIVEGKNLVKKHIKQGQGHEGGIFTVEAPIHASNVQVIDPVTRKPCKVGTKYLEDGSKVRVSRGIGASGSIIPRPEILKIRTTPRPTVLGPKDTPMDLVLEKTYDAKTGRGMPEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo