Glyma07g29230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g29230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g29230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g29230

Feature Type:	gene_model
Chromosome:	Gm07
Start:	33986388
stop:	33987130
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g29230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65840	AT	Annotation by Michelle Graham. TAIR10: polyamine oxidase 4 \| chr1:24490173-24492728 FORWARD LENGTH=497	SoyBase	E_val: 4.00E-45	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0009805	GO-bp	Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0008131	GO-mf	Annotation by Michelle Graham. GO Molecular Function: primary amine oxidase activity	SoyBase	N/A	ISS
GO:0046592	GO-mf	Annotation by Michelle Graham. GO Molecular Function: polyamine oxidase activity	SoyBase	N/A	ISS
UniRef100_G7J7X8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Polyamine oxidase n=2 Tax=Medicago truncatula RepID=G7J7X8_MEDTR	SoyBase	E_val: 3.00E-54	ISS
UniRef100_UPI000233AFA8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AFA8 related cluster n=1 Tax=unknown RepID=UPI000233AFA8	SoyBase	E_val: 2.00E-69	ISS

Expression Patterns of Glyma07g29230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g29230 not represented in the dataset	Glyma07g29230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g29230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g29230

Limit To All Plant Sequences

>Glyma07g29230.1   sequence type=CDS   gene model=Glyma07g29230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTACACTCTATCATATGGGTGATGATAACTGTGTCATATATGATCATGACTTAGAAAGCTGTATGCTATTTAACATTGATGGTCATCAAGTCCCTCAACACATTATGATGGAAGTTGGAGACACTTACAAGAGAATTCTGGCAGAGACAGCAAAAGTGAGGGATGAGCATCCTGATGACATGCCTATTCTCCAAGCAATTTCAATTGTGTTAAATAGACATCCAGAACTAAGGCAACAAGAACTTGTTCATGAAGTGCTGCAATGGTATATATGCAGAATGGAAGCTTGGTTTGCTTTTGATGCGATTATCATACCACTGAAAACCTGGGATCAGGCAAGTGCCATTATATTA

Predicted protein sequences of Glyma07g29230

Limit To All Plant Sequences

>Glyma07g29230.1   sequence type=predicted peptide   gene model=Glyma07g29230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LTLYHMGDDNCVIYDHDLESCMLFNIDGHQVPQHIMMEVGDTYKRILAETAKVRDEHPDDMPILQAISIVLNRHPELRQQELVHEVLQWYICRMEAWFAFDAIIIPLKTWDQASAIIL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain