SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g29210

Feature Type:gene_model
Chromosome:Gm07
Start:33946473
stop:33947186
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g29210
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09070AT Annotation by Michelle Graham. TAIR10: soybean gene regulated by cold-2 | chr1:2927767-2928741 FORWARD LENGTH=324 SoyBaseE_val: 7.00E-18ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0000326GO-cc Annotation by Michelle Graham. GO Cellular Compartment: protein storage vacuole SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00168PFAM C2 domain JGI ISS
UniRef100_B8XJZ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cold-regulated protein n=1 Tax=Glycine max RepID=B8XJZ3_SOYBN SoyBaseE_val: 8.00E-29ISS
UniRef100_I1KL15UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KL15_SOYBN SoyBaseE_val: 9.00E-115ISS

Expression Patterns of Glyma07g29210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29210 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g177900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g29210
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g29210
>Glyma07g29210.2   sequence type=CDS   gene model=Glyma07g29210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATACAGAACGTTGGAACTTAACCTCACATCAGCAAAGGTCTTAAAAGATGTAAACCGTCCATCATGGGAAGAAGAAGACCTCTTCTCGGAGATGGGGCTATACGTCGTCGTCTCACTCCCCGGCAATAATGAAGAGTTCAAGACTCCGGTGGACCGAAGCGGCGGCACTGACCCCGAATGGAATTTTCCGATCAAATTCACCTTCGAAGAATCGCTGCTGCAGCAGGACCGCTTGACCCTCCAAATGAAGCTTTGCTACGACCATCACACCGAGACCCACATCATCGGCGAGGTCCATGTCTCGCTTAGCCAGCTCGTCGACCTAAATACTCCTGAAAACCTATTCTTTAACCACGTCAGTTACTTGCTCAGAGAACAGTCCTCCGGATGCCCTAAGGGAATCTTGGACTTCTTCTACAAATTCGGCGAAAAGTTTACGTCTCGGGTGAAGAATTTTCCGACGCCGAGTCCCGGGGCACGGAGTACGTAG
Predicted protein sequences of Glyma07g29210
>Glyma07g29210.2   sequence type=predicted peptide   gene model=Glyma07g29210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEYRTLELNLTSAKVLKDVNRPSWEEEDLFSEMGLYVVVSLPGNNEEFKTPVDRSGGTDPEWNFPIKFTFEESLLQQDRLTLQMKLCYDHHTETHIIGEVHVSLSQLVDLNTPENLFFNHVSYLLREQSSGCPKGILDFFYKFGEKFTSRVKNFPTPSPGARST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo