Glyma07g29183 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g29183): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g29183): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g29183

Feature Type:	gene_model
Chromosome:	Gm07
Start:	33939199
stop:	33940065
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g29183

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16080	AT	Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: apoplast, chloroplast stroma, chloroplast, chloroplast envelope; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; Has 81 Blast hits to 81 proteins in 28 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 62; Viruses - 0; Other Eukaryotes - 17 (source: NCBI BLink). \| chr1:5514394-5515761 FORWARD LENGTH=313	SoyBase	E_val: 8.00E-35	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
UniRef100_I1KGQ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KGQ2_SOYBN	SoyBase	E_val: 6.00E-44	ISS
UniRef100_Q014K3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WGS project CAID00000000 data, contig chromosome 07 n=1 Tax=Ostreococcus tauri RepID=Q014K3_OSTTA	SoyBase	E_val: 7.00E-15	ISS

Expression Patterns of Glyma07g29183

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g29183 not represented in the dataset	Glyma07g29183 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29183 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g29183

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g29183

Limit To All Plant Sequences

>Glyma07g29183.1   sequence type=CDS   gene model=Glyma07g29183   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCCTCAGCAATGTCTATAGCTTTTATATAGAGTTTGCTTTGGAGGGTTGGTTGTCCAGCCTTATAACAGAACTGGCACCAGCAGCAGTAAGTGAAAAGGGGTTAACATTTGAAGAAGCCATGGAAGAGCGCTTATGTGTATATTCTCGAGTTGTAGCCCACTTTCCCACGGCAGTTAAGGAGTTCAAATGGAGAAATGGTTGGTTTTGTTCTCTCTCTAAGAAGGCTACTACCCAAGGCAAGCCAGACCCATGCCATTTGCATTCCCAATGGCTAAAAGAGTTGAGAATTGTATGA

Predicted protein sequences of Glyma07g29183

Limit To All Plant Sequences

>Glyma07g29183.1   sequence type=predicted peptide   gene model=Glyma07g29183   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLSNVYSFYIEFALEGWLSSLITELAPAAVSEKGLTFEEAMEERLCVYSRVVAHFPTAVKEFKWRNGWFCSLSKKATTQGKPDPCHLHSQWLKELRIV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain