SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g29046): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g29046): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g29046

Feature Type:gene_model
Chromosome:Gm07
Start:33534174
stop:33536425
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g29046
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63310AT Annotation by Michelle Graham. TAIR10: nucleoside diphosphate kinase 2 | chr5:25372122-25373838 REVERSE LENGTH=231 SoyBaseE_val: 4.00E-77ISS
GO:0006165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside diphosphate phosphorylation SoyBaseN/AISS
GO:0006183GO-bp Annotation by Michelle Graham. GO Biological Process: GTP biosynthetic process SoyBaseN/AISS
GO:0006228GO-bp Annotation by Michelle Graham. GO Biological Process: UTP biosynthetic process SoyBaseN/AISS
GO:0006241GO-bp Annotation by Michelle Graham. GO Biological Process: CTP biosynthetic process SoyBaseN/AISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009585GO-bp Annotation by Michelle Graham. GO Biological Process: red, far-red light phototransduction SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004550GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside diphosphate kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
KOG0888 KOG Nucleoside diphosphate kinase JGI ISS
PTHR11349Panther NUCLEOSIDE DIPHOSPHATE KINASE JGI ISS
PF00334PFAM Nucleoside diphosphate kinase JGI ISS
UniRef100_I1K081UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleoside diphosphate kinase n=1 Tax=Glycine max RepID=I1K081_SOYBN SoyBaseE_val: 3.00E-104ISS
UniRef100_UPI000233B99CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B99C related cluster n=1 Tax=unknown RepID=UPI000233B99C SoyBaseE_val: 6.00E-112ISS

Expression Patterns of Glyma07g29046
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g29046 not represented in the dataset
Glyma07g29046 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29046 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g29046
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g29046
>Glyma07g29046.1   sequence type=CDS   gene model=Glyma07g29046   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCCTTCACAATCCCATCTTTTCTTATATCACCCTCCTCCCTATGCCAATGCTAAAACCCTTCGTGCCAGAACCTCCTCCAAACTCGTCATTTTCCTTCTCCACTTAATTGCTTCTTTGGAACAAGTTGACCATACTTACATAATGGTCAAGCCCGACGGCGTGCAACGTGGCCTCGTGGGAGAAATTATTTCTAGGTTTGAGAAGAAGGGGTTTAAGTTAACCGGCTTGAAGCTCTTTGAGTGCTTGTGTGAGCATTACAAGGATCTAAAACAAAAGTTATTCTTCCCCAAGCTGATTGACTATATTACTTCAGGTCCTGTTGTGTGTATGGCTTGGGAGGGGGTTGGGATAGTCGCATCGGCCCGTAAACTTATAGGCGCTACATATCCTCTTCAAGCTGAACCAGGCACAATAAGAGGAGACCTTGCTGTTCAGACACGAAGGAATGTTGTTCATGGCAGTGACAATCCTGAGAATGGCAAGCGTGAAATAGGTAAGGCCTCTTATGCTATCCAGTTTAACCCAAATACATGCAACAAACATAGATGTGAATTGTGA
Predicted protein sequences of Glyma07g29046
>Glyma07g29046.1   sequence type=predicted peptide   gene model=Glyma07g29046   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FPSQSHLFLYHPPPYANAKTLRARTSSKLVIFLLHLIASLEQVDHTYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFECLCEHYKDLKQKLFFPKLIDYITSGPVVCMAWEGVGIVASARKLIGATYPLQAEPGTIRGDLAVQTRRNVVHGSDNPENGKREIGKASYAIQFNPNTCNKHRCEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo