SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g29015

Feature Type:gene_model
Chromosome:Gm07
Start:33461416
stop:33461919
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g29015
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69690AT Annotation by Michelle Graham. TAIR10: TCP family transcription factor | chr1:26216449-26217426 FORWARD LENGTH=325 SoyBaseE_val: 4.00E-29ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010229GO-bp Annotation by Michelle Graham. GO Biological Process: inflorescence development SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF03634PFAM TCP family transcription factor JGI ISS
UniRef100_G7JQY3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor PCF2 n=1 Tax=Medicago truncatula RepID=G7JQY3_MEDTR SoyBaseE_val: 3.00E-47ISS
UniRef100_UPI000233F4DCUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F4DC related cluster n=1 Tax=unknown RepID=UPI000233F4DC SoyBaseE_val: 5.00E-60ISS

Expression Patterns of Glyma07g29015
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g29015 not represented in the dataset
Glyma07g29015 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g29015 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g177200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g29015
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g29015
>Glyma07g29015.1   sequence type=CDS   gene model=Glyma07g29015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGAGGCGAGGATCTCCACCACCATCACCACCACCACCACCGTCACAACAACTTCCCATTCCAGCTACTTGAGAAGAAAGAAGACCAAGAAACCGCCTCATGCTCCACCTCCTCCCTTTACCCTTCCCTAGAAATCTCCACGAAACCGAGCATGTCCAATTCCACCCGATCCAACCAGCTCGTTGTGGTGGCTATGGTGGAGGCTCCTAACAGCAAAAAGCCTCCGCCGAAGCGCACCTCGACCAAGGACCGACACATGAAGCTCACCCGCGAGCTGTGCCACAAGTCAGACGGTGAAACCATCGAGTGGCTCCTCCAGCAAGTGGAGCCTGCTGTGATCGCCGCCACCGGTACCGGCATCATCCCCGCCAACTTCACCTCCCTGAACATCTCCCTACGTAGTTCTGGCTCCTCCATGTCCGTCCCCTACCAGCTCTGA
Predicted protein sequences of Glyma07g29015
>Glyma07g29015.1   sequence type=predicted peptide   gene model=Glyma07g29015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGEDLHHHHHHHHRHNNFPFQLLEKKEDQETASCSTSSLYPSLEISTKPSMSNSTRSNQLVVVAMVEAPNSKKPPPKRTSTKDRHMKLTRELCHKSDGETIEWLLQQVEPAVIAATGTGIIPANFTSLNISLRSSGSSMSVPYQL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo