Glyma07g28865 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g28865): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g28865): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g28865

Feature Type:	gene_model
Chromosome:	Gm07
Start:	33033050
stop:	33033938
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g28865

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G64040	AT	Annotation by Michelle Graham. TAIR10: type one serine/threonine protein phosphatase 3 \| chr1:23758626-23760274 REVERSE LENGTH=322	SoyBase	E_val: 5.00E-59	ISS
GO:0006470	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation	SoyBase	N/A	ISS
GO:0000164	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: protein phosphatase type 1 complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004722	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
PTHR11668	Panther	SERINE/THREONINE PROTEIN PHOSPHATASE	JGI		ISS
PTHR11668:SF136	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00149	PFAM	Calcineurin-like phosphoesterase	JGI		ISS
UniRef100_I1NI31	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1NI31_SOYBN	SoyBase	E_val: 3.00E-85	ISS
UniRef100_UPI0002337D44	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337D44 related cluster n=1 Tax=unknown RepID=UPI0002337D44	SoyBase	E_val: 8.00E-105	ISS

Expression Patterns of Glyma07g28865

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g28865 not represented in the dataset	Glyma07g28865 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g28865 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g176300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g28865

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g28865

Limit To All Plant Sequences

>Glyma07g28865.1   sequence type=CDS   gene model=Glyma07g28865   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCACTTCTCTCCCTCTCCCTCCACTCTTCTTCTCCTACCTTCAAGATCTTATCCATAGCTTCCTATGGTGAGGTACAAGTGAGGCTTTGGAAAGTGTTAATAGAATGTTTCAACTGCTTGCAAGTGACAGCTCTAATTGATGAAAAGATATTTTGTATGCATGGTGGACTCTCTCCTGAGTTACACAATCAAAATCAGATAAAGAGTTTGTCGCGTCCTATTAAGGTGCCTAAAACTGGTCTACTATGTGATCTCCTTTGGTCTGATCCTAGTAGTGACATTGGGGGTAGGGGAGAGAATGAATGCAGAGTTTCCTATACTTTTGGTGCTGATAGGGTCACAAAATTCCTTCAGAAGCATGATCTTGATTTCATTTGCAGGGCCCATCAGTTTGATAATGTTGGTGCTATGATGACTGTTGGTGAGACACTTGTGTGCTCTTTTCAAATATTGAAGCCAGTAGAAAATAAAAAGCCTAATAAGTTTGGCTTTGGGAGCACAACTACAGTTAAGCATAGTACTCCAACAAAAGCCAAGGTTTTTTGA

Predicted protein sequences of Glyma07g28865

Limit To All Plant Sequences

>Glyma07g28865.1   sequence type=predicted peptide   gene model=Glyma07g28865   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPLLSLSLHSSSPTFKILSIASYGEVQVRLWKVLIECFNCLQVTALIDEKIFCMHGGLSPELHNQNQIKSLSRPIKVPKTGLLCDLLWSDPSSDIGGRGENECRVSYTFGADRVTKFLQKHDLDFICRAHQFDNVGAMMTVGETLVCSFQILKPVENKKPNKFGFGSTTTVKHSTPTKAKVF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain