|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G51950 | AT | Annotation by Michelle Graham. TAIR10: Zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein | chr3:19278244-19280407 REVERSE LENGTH=540 | SoyBase | E_val: 9.00E-16 | ISS |
GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0005575 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cellular component | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
PTHR24009 | Panther | FAMILY NOT NAMED | JGI | ISS | |
UniRef100_B9RIF6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9RIF6_RICCO | SoyBase | E_val: 1.00E-14 | ISS |
UniRef100_I1LNZ6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LNZ6_SOYBN | SoyBase | E_val: 8.00E-31 | ISS |
Glyma07g28690 not represented in the dataset |
Glyma07g28690 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.07g176100 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g28690.1 sequence type=CDS gene model=Glyma07g28690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCCAAGCTTCAAACTCCTAATGATTTGATGAGTTCTAACCATTTAGTTATTGGTTCTTCTACTTCTTTATTGTTCTTACCCTTTTATGAAAACAGTGACTCCGATCCAATTGATGAGTTCCAACTTCAAGACCAACTTGCTTTCTTGAATGATGGTTCTCCAACTAGTACTACTCTTGCCCACAAGAACAACTCAGATATGTTTTACCCTTTTTTCAAATTTGCTTCCAGGAAAATCTACTTAAATCTCCTAGCAGATAGCACTTTCAGGGAGGAAGATGTTTCAAATTACTTCAGCATATATGGTCCAGTCCAAGACGTGAGGATCCCATACCATCAGAAGCGAATATAA
>Glyma07g28690.1 sequence type=predicted peptide gene model=Glyma07g28690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSKLQTPNDLMSSNHLVIGSSTSLLFLPFYENSDSDPIDEFQLQDQLAFLNDGSPTSTTLAHKNNSDMFYPFFKFASRKIYLNLLADSTFREEDVSNYFSIYGPVQDVRIPYHQKRI*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||