Glyma07g28040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g28040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g28040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g28040

Feature Type:	gene_model
Chromosome:	Gm07
Start:	31814833
stop:	31817013
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g28040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37990	AT	Annotation by Michelle Graham. TAIR10: elicitor-activated gene 3-2 \| chr4:17855964-17857388 FORWARD LENGTH=359	SoyBase	E_val: 5.00E-62	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009626	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0045551	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cinnamyl-alcohol dehydrogenase activity	SoyBase	N/A	ISS
GO:0047681	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aryl-alcohol dehydrogenase (NADP+) activity	SoyBase	N/A	ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF285	Panther	QUINONE OXIDOREDUCTASE-RELATED	JGI		ISS
PF08240	PFAM	Alcohol dehydrogenase GroES-like domain	JGI		ISS
UniRef100_B9IIG5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cinnamyl alcohol dehydrogenase-like protein n=1 Tax=Populus trichocarpa RepID=B9IIG5_POPTR	SoyBase	E_val: 4.00E-83	ISS
UniRef100_UPI0002337D3E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337D3E related cluster n=1 Tax=unknown RepID=UPI0002337D3E	SoyBase	E_val: 1.00E-124	ISS

Expression Patterns of Glyma07g28040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g28040 not represented in the dataset	Glyma07g28040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g28040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g175200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g28040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g28040

Limit To All Plant Sequences

>Glyma07g28040.2   sequence type=CDS   gene model=Glyma07g28040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTAGGTCTTGCAAGTCGTGCCAAAACTGTGTCAACAATGTTGAGAATCATTGCCAACAAAAGATTCTCGCATATGGTGCCAAGTACGTGGATGACACCATTACGTATGGGGGGTTCTCTGACTTCATGGTTGTAGATGAGCACTTTGTTGTTAGCATTCTAAGTGGCCTACCTCTTGATGTTGCTGCTCCTTTCCTTGGTGCAGGCATCACGGTGTATGGTCCTTTGAGATATTTTGGGCTTGATAAACCTAACATGCATCTGGGTGTGGTTGGCCTTGGTGGATTAGGCCATCTAGCTGTCAAGTTTGCAAAAGCCCTTGATTTGAAGGTCAGTGTCATCATCAGTACTTCTCCAAATAAGAAGAAAAAAGCCATACAACATCTTGGAGCTGATTCCTTTGTGGCTGCAGTGTGCACCTTGGACGGTATAATTGATACTATCTCAGCAATGCATCCTCTCACGCCCTTGATTGATCTGTTGAAGTCTCATGGGAAACTTGTAATGGTTGGGGCACCTGAGAAGCCTTTGGAATTGCTACTCCCGTCTTTAATTATGGGTAGAAAAACTATAGCTGCTAGCTACATTGGAGGAGTCAAGAGACACAAGAAATTATTGATTTCGCCACTGAACACAATGTTAGACCTCAAATTGAGGTAA

Predicted protein sequences of Glyma07g28040

Limit To All Plant Sequences

>Glyma07g28040.2   sequence type=predicted peptide   gene model=Glyma07g28040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VRSCKSCQNCVNNVENHCQQKILAYGAKYVDDTITYGGFSDFMVVDEHFVVSILSGLPLDVAAPFLGAGITVYGPLRYFGLDKPNMHLGVVGLGGLGHLAVKFAKALDLKVSVIISTSPNKKKKAIQHLGADSFVAAVCTLDGIIDTISAMHPLTPLIDLLKSHGKLVMVGAPEKPLELLLPSLIMGRKTIAASYIGGVKRHKKLLISPLNTMLDLKLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain