SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g27971): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g27971): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g27971

Feature Type:gene_model
Chromosome:Gm07
Start:31614711
stop:31616450
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g27971
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G21430AT Annotation by Michelle Graham. TAIR10: Papain family cysteine protease | chr2:9171964-9173301 REVERSE LENGTH=361 SoyBaseE_val: 4.00E-46ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
PTHR12411Panther CYSTEINE PROTEASE FAMILY C1-RELATED JGI ISS
PTHR12411:SF42Panther CATHEPSIN-W-RELATED JGI ISS
PF00112PFAM Papain family cysteine protease JGI ISS
PF08246PFAM Cathepsin propeptide inhibitor domain (I29) JGI ISS
UniRef100_O24322UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase n=1 Tax=Phaseolus vulgaris RepID=O24322_PHAVU SoyBaseE_val: 8.00E-62ISS
UniRef100_UPI0002337BEDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337BED related cluster n=1 Tax=unknown RepID=UPI0002337BED SoyBaseE_val: 2.00E-94ISS

Expression Patterns of Glyma07g27971
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g27971 not represented in the dataset
Glyma07g27971 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g27971 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g174700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g27971
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g27971
>Glyma07g27971.1   sequence type=CDS   gene model=Glyma07g27971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCGCTACTCCTTCCTCTTGGCCCTCCTCCTCCTCCTCTTTGCCGTCGTGACCAGCACCACTGATGACATCCTGATTCGTCAGGTGGTGCCGGATGCCGTCAGTGAAGCAACAGAGAAGGAGGATGAGGACCACCTTCTTAACGAGGAGCACCACTTCACGAGCTTCAAGGCGAAGTTCGGGAAGAAGTATGTGACCAAGGAGGAGCACAACCGTCGCTTCGGCGTCTTCAAGTCCAACCTCCATAGAGCGAGGCTGCATGCCAAGCTCGACCCGTCCGTCGTCCACAACATCACCAAATTGTCTGATCTCACTTCGACCGAGTTCCACAAAGGAGCCATCACTAACGTCAAGGACCAAGGGGCGTGTGGTTTGTGCTGGTCTTTCAGTACCACGAGATCATTGGAAGGAGCTCATTATCTAGCCACTGGTGAGCTTGGGAGCCTTAGCGAGCAACAGCTTGTGGATTGCGACCATGTGGATTTTACAAGGTTCAAAGAAATCTCAAGAACCGCAGGTTGCTTGGGGACTGGATGTAGGCACGGTTTGTGGCCGAACTAG
Predicted protein sequences of Glyma07g27971
>Glyma07g27971.1   sequence type=predicted peptide   gene model=Glyma07g27971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARYSFLLALLLLLFAVVTSTTDDILIRQVVPDAVSEATEKEDEDHLLNEEHHFTSFKAKFGKKYVTKEEHNRRFGVFKSNLHRARLHAKLDPSVVHNITKLSDLTSTEFHKGAITNVKDQGACGLCWSFSTTRSLEGAHYLATGELGSLSEQQLVDCDHVDFTRFKEISRTAGCLGTGCRHGLWPN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo