Glyma07g27710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g27710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g27710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g27710

Feature Type:	gene_model
Chromosome:	Gm07
Start:	31111505
stop:	31111771
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g27710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00090	AT	Annotation by Michelle Graham. TAIR10: structural constituent of ribosome;protein binding \| chrM:25482-28733 REVERSE LENGTH=556	SoyBase	E_val: 3.00E-23	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005763	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial small ribosomal subunit	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR11760	Panther	30S RIBOSOMAL PROTEIN S3	JGI		ISS
PTHR11760:SF12	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00189	PFAM	Ribosomal protein S3, C-terminal domain	JGI		ISS
UniRef100_Q35644	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein S3 (Fragment) n=2 Tax=Petunia sp. RepID=Q35644_PETSP	SoyBase	E_val: 8.00E-40	ISS
UniRef100_Q35644	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S3 (Fragment) n=2 Tax=Petunia sp. RepID=Q35644_PETSP	SoyBase	E_val: 8.00E-40	ISS

Expression Patterns of Glyma07g27710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g27710 not represented in the dataset	Glyma07g27710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g27710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g27710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g27710

Limit To All Plant Sequences

>Glyma07g27710.1   sequence type=CDS   gene model=Glyma07g27710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACAAGATCATTTTGTTCCATTTTTAGTAGAATAGTGAAGGATATTCCATTAGTAATGAAAAAAGGGGTTGAGGGGATCCATATATGTTGTTCAAGTCGATCAGAAGGCATAAAAATAACTAGAACTGAATGTGGAAAGTATGGAAAAACATCCCGTAATGTATTTAACAAGAAAATTGATTATGCTTCTGTGAAAGTATCTACTCATTACGAAATCTCAGGTGTCAAAGTGTGGATTTCATATAGGAACGAGGTGGCATTGGAGTAA

Predicted protein sequences of Glyma07g27710

Limit To All Plant Sequences

>Glyma07g27710.1   sequence type=predicted peptide   gene model=Glyma07g27710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TRSFCSIFSRIVKDIPLVMKKGVEGIHICCSSRSEGIKITRTECGKYGKTSRNVFNKKIDYASVKVSTHYEISGVKVWISYRNEVALE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain