Glyma07g27350 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g27350

Feature Type:	gene_model
Chromosome:	Gm07
Start:	30349471
stop:	30350110
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g27350

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G11670	AT	Annotation by Michelle Graham. TAIR10: UDP-Glycosyltransferase superfamily protein \| chr3:3681679-3684495 REVERSE LENGTH=639	SoyBase	E_val: 2.00E-111	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0042550	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem I stabilization	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009707	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast outer membrane	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0035250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-galactosyltransferase activity	SoyBase	N/A	ISS
GO:0046480	GO-mf	Annotation by Michelle Graham. GO Molecular Function: galactolipid galactosyltransferase activity	SoyBase	N/A	ISS
PTHR12526	Panther	GLYCOSYLTRANSFERASE	JGI		ISS
PTHR12526:SF202	Panther	OS11G0158400 PROTEIN	JGI		ISS
UniRef100_Q6DW76	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Digalactosyldiacylglycerol synthase 1, chloroplastic n=1 Tax=Glycine max RepID=DGDG1_SOYBN	SoyBase	E_val: 7.00E-119	ISS
UniRef100_Q6DW76	UniRef	Annotation by Michelle Graham. Best UniRef hit: Digalactosyldiacylglycerol synthase 1, chloroplastic n=1 Tax=Glycine max RepID=DGDG1_SOYBN	SoyBase	E_val: 7.00E-119	ISS

Expression Patterns of Glyma07g27350

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g27350 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g27350

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g27350

Limit To All Plant Sequences

>Glyma07g27350.1   sequence type=CDS   gene model=Glyma07g27350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GACAATGAAAGACATGTTGCAATAGTGACAACTACTAGTCTTCCTTGGATGACGGGAAGAGCTGTAAACCCACTATTTCGAGGTGCATATTTATCAGAATTTGCAAAGCAGAAAGTCACTCTGCTGGTTCCATGGCTTTGTAAATCAGATCAAGAACTGGTTTGTCCCAACAATCTCACTTTTACTTCACCAGAAGAACAAGAAGCTTATATGCGTAGCTGGCTTGAGGAAAGGATTGGTTTTAAGGCAGACTTCAAAATTTCTTTTTATCCTGGGAAGTTTTCGGAAGCAAGGCGGAGTATAATACCTGCTGGAGATACTTCTCAATTTATACCATCCAGGGATGCTGACATTGCTATCTTGAAAGAACCAGAACATTTGAATTGGTATCATCATGGAAAGCGTTGGACGAACAAATTCAACCATGTTGTTGGTATTGTCCACACAAATTATATAGAATACATCAAGAGGGAGAAAAATGGGGCACTCCAGGTATTCCTCGTGAAACACATAAACAACTGGGTTACAAGAGCATACTGCCACAAG

Predicted protein sequences of Glyma07g27350

Limit To All Plant Sequences

>Glyma07g27350.1   sequence type=predicted peptide   gene model=Glyma07g27350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DNERHVAIVTTTSLPWMTGRAVNPLFRGAYLSEFAKQKVTLLVPWLCKSDQELVCPNNLTFTSPEEQEAYMRSWLEERIGFKADFKISFYPGKFSEARRSIIPAGDTSQFIPSRDADIAILKEPEHLNWYHHGKRWTNKFNHVVGIVHTNYIEYIKREKNGALQVFLVKHINNWVTRAYCHK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain