SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g26640

Feature Type:gene_model
Chromosome:Gm07
Start:29586247
stop:29587587
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g26640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31960AT Annotation by Michelle Graham. TAIR10: glucan synthase-like 3 | chr2:13589545-13600066 FORWARD LENGTH=1950 SoyBaseE_val: 2.00E-88ISS
GO:0006075GO-bp Annotation by Michelle Graham. GO Biological Process: (1->3)-beta-D-glucan biosynthetic process SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0000148GO-cc Annotation by Michelle Graham. GO Cellular Compartment: 1,3-beta-D-glucan synthase complex SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003843GO-mf Annotation by Michelle Graham. GO Molecular Function: 1,3-beta-D-glucan synthase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PTHR12741Panther UNCHARACTERIZED DUF605 JGI ISS
PTHR12741:SF4Panther gb def: Hypothetical protein F10M23.90 (AT4g26750/F10M23 90) (Hypothetical protein AT4g2 JGI ISS
UniRef100_B9SQ55UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transferase, transferring glycosyl groups, putative n=1 Tax=Ricinus communis RepID=B9SQ55_RICCO SoyBaseE_val: 4.00E-89ISS
UniRef100_I1KTQ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KTQ1_SOYBN SoyBaseE_val: 9.00E-125ISS

Expression Patterns of Glyma07g26640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g26640 not represented in the dataset
Glyma07g26640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g26640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g26640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g26640
>Glyma07g26640.1   sequence type=CDS   gene model=Glyma07g26640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTTGAGTTGTATGGGATGTTAGTTGGGAATGTTAGTCCACTGACTGGTGAACTTGTAAAGCCTGCCTATGGTGGTGATAATGAGGCTTTTCTTATGAAAGTAGTAAAACCAATATATGATGTAATAGCCAAGGAAGCTGAGAGAAGTAATATGGGAAAAGCAAAGCATTCTCACTGGAGAAATTATGATGATTTAAATGAATATTTTTGGTCAGTTGATTGTTTTCGGCTAGGTTGGCCTATGCGTGTTGACTCTGATTTCTTCTCTGTTCCTTTTCCTCAACAGCAACATCAAGTTAACAAACACGAGGAAAACAGAGGTCCTGCTTCAGACCGGTGGAGTGGGAAAACTAATTTTGTTGAAATACGCACATTTTGGCATATATTTAGAAGTTTTGATAGAATGTGGAGCTTTTATATACTATGTTTACAGGCGATGATAACCATTGCTTGGAATGGTTCCGGAAAATTAAGCTCAATATTTGATGGTGATATTTTCAAGCAAGTTCTCAGCATCTTCATAACTGCTGCAATATTGAAGCTTGCACAA
Predicted protein sequences of Glyma07g26640
>Glyma07g26640.1   sequence type=predicted peptide   gene model=Glyma07g26640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFELYGMLVGNVSPLTGELVKPAYGGDNEAFLMKVVKPIYDVIAKEAERSNMGKAKHSHWRNYDDLNEYFWSVDCFRLGWPMRVDSDFFSVPFPQQQHQVNKHEENRGPASDRWSGKTNFVEIRTFWHIFRSFDRMWSFYILCLQAMITIAWNGSGKLSSIFDGDIFKQVLSIFITAAILKLAQ






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo