|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G42560 | AT | Annotation by Michelle Graham. TAIR10: Abscisic acid-responsive (TB2/DP1, HVA22) family protein | chr5:17015573-17016969 FORWARD LENGTH=296 | SoyBase | E_val: 2.00E-29 | ISS |
| GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009755 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR12300 | Panther | HVA22-LIKE PROTEINS | JGI | ISS | |
| PTHR12300:SF20 | Panther | HVA22-LIKE PROTEIN | JGI | ISS | |
| PF03134 | PFAM | TB2/DP1, HVA22 family | JGI | ISS | |
| UniRef100_G7J4Q8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein i n=1 Tax=Medicago truncatula RepID=G7J4Q8_MEDTR | SoyBase | E_val: 7.00E-28 | ISS |
| UniRef100_UPI0002337BD8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337BD8 related cluster n=1 Tax=unknown RepID=UPI0002337BD8 | SoyBase | E_val: 1.00E-37 | ISS |
|
Glyma07g26528 not represented in the dataset |
Glyma07g26528 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g170600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g26528.1 sequence type=CDS gene model=Glyma07g26528 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTACAGTGAAGCTAAGTTGGAATTTTTCATATTTTTGTGGTACCCTAAAACTAAGGGAACAACATATGTGTATGACTCCTTCTTCAGACTATATGTTGCAAAACATGCGACAGAAATTGATCGCAACTTATTGGAACTAAGGACAAGGGCAGGGGATATTGCAGTTTTGTATTGGCAAAGATTGTCATTTGATACGTTTTCCTCTCCGATGATTGAAAAAGATCCAAATGATGCAAGTGAAGGGGCAGAGGATCAATGGAATGTTCAATTGTGA
>Glyma07g26528.1 sequence type=predicted peptide gene model=Glyma07g26528 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MYSEAKLEFFIFLWYPKTKGTTYVYDSFFRLYVAKHATEIDRNLLELRTRAGDIAVLYWQRLSFDTFSSPMIEKDPNDASEGAEDQWNVQL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||