Glyma07g25825 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g25825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g25825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g25825

Feature Type:	gene_model
Chromosome:	Gm07
Start:	28325226
stop:	28326902
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g25825

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G17770	AT	Annotation by Michelle Graham. TAIR10: trehalose phosphatase/synthase 5 \| chr4:9877055-9880084 FORWARD LENGTH=862	SoyBase	E_val: 6.00E-94	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0005992	GO-bp	Annotation by Michelle Graham. GO Biological Process: trehalose biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004805	GO-mf	Annotation by Michelle Graham. GO Molecular Function: trehalose-phosphatase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PTHR10788	Panther	TREHALOSE-6-PHOSPHATE SYNTHASE	JGI		ISS
PTHR10788:SF6	Panther	TREHALOSE 6-PHOSPHATE SYNTHASE	JGI		ISS
PF02358	PFAM	Trehalose-phosphatase	JGI		ISS
UniRef100_B9SNT9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Trehalose-6-phosphate synthase, putative n=1 Tax=Ricinus communis RepID=B9SNT9_RICCO	SoyBase	E_val: 4.00E-104	ISS
UniRef100_I1LET3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LET3_SOYBN	SoyBase	E_val: 5.00E-139	ISS

Expression Patterns of Glyma07g25825

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g25825 not represented in the dataset	Glyma07g25825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g25825 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g169000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g25825

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g25825

Limit To All Plant Sequences

>Glyma07g25825.1   sequence type=CDS   gene model=Glyma07g25825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCGGCCTGGGTCGATGAGTATAACACCTAATGCTGAAGCGGTTAGCATCTTGAACATCTTGTGCAGGGACACCAAGAATTGTGTTTTCATTGTAAGTGGAACGGAGAGAAAGACTTTTACTGAATGGTTTTCTTCTTGTGAAAGGATAGGAATCGTTGCAGAGCATGGTTATTTTGTGAGGACAAATCGAAATGCAGAATGGGATACTTGGTGTCCAGTACCTGATTTTGAGTGGAAACAGATTGCTGAGCCGATTATGCAATTATATATGGAAACAACTGATGGTTCAAACATAGAGGCCAAAGAAAGTGCTCTAGTTTGGAATTACGAGTATGCAAACCGAGACTTTGGTTCATGCCAAGCTAAGGAGCTTTTTGATCATCTGGAAAGTGCTCTTGCCAATGAGCCTGTTTCTGTTAAAAGTAGTCCAAACATTGTAGTAGTGAAACCTCAGGGTGTGAGTAACGGTATTGTAGCAGAACGTCTTCTCTTAACAATGCAACAAAAGGGAGTGTTTCCAGATTTTGTTCTATGCATTGGAGATGACAGATCAGACGAGGACATGTTTGGGGTAATCATGAATGGAAAGGCAACCTTATCTCCAGTTGCTGAAGTGTTTCCATGCACTGTTGGCTAG

Predicted protein sequences of Glyma07g25825

Limit To All Plant Sequences

>Glyma07g25825.1   sequence type=predicted peptide   gene model=Glyma07g25825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRPGSMSITPNAEAVSILNILCRDTKNCVFIVSGTERKTFTEWFSSCERIGIVAEHGYFVRTNRNAEWDTWCPVPDFEWKQIAEPIMQLYMETTDGSNIEAKESALVWNYEYANRDFGSCQAKELFDHLESALANEPVSVKSSPNIVVVKPQGVSNGIVAERLLLTMQQKGVFPDFVLCIGDDRSDEDMFGVIMNGKATLSPVAEVFPCTVG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain