SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g24960

Feature Type:gene_model
Chromosome:Gm07
Start:27452390
stop:27452999
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40870AT Annotation by Michelle Graham. TAIR10: uridine kinase/uracil phosphoribosyltransferase 1 | chr5:16375021-16378384 FORWARD LENGTH=486 SoyBaseE_val: 1.00E-46ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0044206GO-bp Annotation by Michelle Graham. GO Biological Process: UMP salvage SoyBaseN/AISS
GO:2000904GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of starch metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004845GO-mf Annotation by Michelle Graham. GO Molecular Function: uracil phosphoribosyltransferase activity SoyBaseN/AISS
GO:0004849GO-mf Annotation by Michelle Graham. GO Molecular Function: uridine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
PTHR10285Panther URIDINE KINASE RELATED JGI ISS
PTHR10285:SF6Panther URIDINE CYTIDINE KINASE I JGI ISS
PF00485PFAM Phosphoribulokinase / Uridine kinase family JGI ISS
UniRef100_I1MLJ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Uridine kinase n=2 Tax=Glycine max RepID=I1MLJ3_SOYBN SoyBaseE_val: 3.00E-71ISS
UniRef100_UPI00023391C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023391C8 related cluster n=1 Tax=unknown RepID=UPI00023391C8 SoyBaseE_val: 2.00E-83ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g24960 not represented in the dataset

Glyma07g24960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g168300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g24960.1   sequence type=CDS   gene model=Glyma07g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCCCATCCTCCGCCACCCCCGCGTCCTCCACTCCCGATTCAACTCTAACCCTCAATTCCCTTCCCAATCAACCCTTCGTCATAGGAGTTTCTGGAGATACTGCCTCGGGCAAAACCACCGTCTGCGATATGATCATTCAACAACTCCATGATCACCGTGTTGTCCTCGTAAATCAGGACTCATTTTATCACTGGTTGAATCCTGAAGAATTGGAACGTGTTCACGAGTACTATTTCGACCACCGTGATGCTTTTGACACGGAGCAGTTGTTAAAGTGCACGAGGAAGCTCATCAGTGGCCAGGGCGTGCATGTTCCCATTTATGACTTCAAGAAGCAGCAACACTCTTCTGATAGTTTTCGCCAG

>Glyma07g24960.1   sequence type=predicted peptide   gene model=Glyma07g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPSSATPASSTPDSTLTLNSLPNQPFVIGVSGDTASGKTTVCDMIIQQLHDHRVVLVNQDSFYHWLNPEELERVHEYYFDHRDAFDTEQLLKCTRKLISGQGVHVPIYDFKKQQHSSDSFRQ







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo