Glyma07g24960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g24960

Feature Type:	gene_model
Chromosome:	Gm07
Start:	27452390
stop:	27452999
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g24960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G40870	AT	Annotation by Michelle Graham. TAIR10: uridine kinase/uracil phosphoribosyltransferase 1 \| chr5:16375021-16378384 FORWARD LENGTH=486	SoyBase	E_val: 1.00E-46	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0009616	GO-bp	Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing	SoyBase	N/A	ISS
GO:0010050	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative phase change	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0016310	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorylation	SoyBase	N/A	ISS
GO:0044206	GO-bp	Annotation by Michelle Graham. GO Biological Process: UMP salvage	SoyBase	N/A	ISS
GO:2000904	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of starch metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004845	GO-mf	Annotation by Michelle Graham. GO Molecular Function: uracil phosphoribosyltransferase activity	SoyBase	N/A	ISS
GO:0004849	GO-mf	Annotation by Michelle Graham. GO Molecular Function: uridine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
PTHR10285	Panther	URIDINE KINASE RELATED	JGI		ISS
PTHR10285:SF6	Panther	URIDINE CYTIDINE KINASE I	JGI		ISS
PF00485	PFAM	Phosphoribulokinase / Uridine kinase family	JGI		ISS
UniRef100_I1MLJ3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Uridine kinase n=2 Tax=Glycine max RepID=I1MLJ3_SOYBN	SoyBase	E_val: 3.00E-71	ISS
UniRef100_UPI00023391C8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023391C8 related cluster n=1 Tax=unknown RepID=UPI00023391C8	SoyBase	E_val: 2.00E-83	ISS

Expression Patterns of Glyma07g24960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g24960 not represented in the dataset	Glyma07g24960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g24960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g168300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g24960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g24960

Limit To All Plant Sequences

>Glyma07g24960.1   sequence type=CDS   gene model=Glyma07g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCCCATCCTCCGCCACCCCCGCGTCCTCCACTCCCGATTCAACTCTAACCCTCAATTCCCTTCCCAATCAACCCTTCGTCATAGGAGTTTCTGGAGATACTGCCTCGGGCAAAACCACCGTCTGCGATATGATCATTCAACAACTCCATGATCACCGTGTTGTCCTCGTAAATCAGGACTCATTTTATCACTGGTTGAATCCTGAAGAATTGGAACGTGTTCACGAGTACTATTTCGACCACCGTGATGCTTTTGACACGGAGCAGTTGTTAAAGTGCACGAGGAAGCTCATCAGTGGCCAGGGCGTGCATGTTCCCATTTATGACTTCAAGAAGCAGCAACACTCTTCTGATAGTTTTCGCCAG

Predicted protein sequences of Glyma07g24960

Limit To All Plant Sequences

>Glyma07g24960.1   sequence type=predicted peptide   gene model=Glyma07g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPSSATPASSTPDSTLTLNSLPNQPFVIGVSGDTASGKTTVCDMIIQQLHDHRVVLVNQDSFYHWLNPEELERVHEYYFDHRDAFDTEQLLKCTRKLISGQGVHVPIYDFKKQQHSSDSFRQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain