Glyma07g23085 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g23085): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g23085): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g23085

Feature Type:	gene_model
Chromosome:	Gm07
Start:	24915528
stop:	24919818
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g23085

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G01350	AT	Annotation by Michelle Graham. TAIR10: quinolinate phoshoribosyltransferase \| chr2:165332-166842 REVERSE LENGTH=281	SoyBase	E_val: 9.00E-36	ISS
GO:0009435	GO-bp	Annotation by Michelle Graham. GO Biological Process: NAD biosynthetic process	SoyBase	N/A	ISS
GO:0019363	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyridine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004514	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nicotinate-nucleotide diphosphorylase (carboxylating) activity	SoyBase	N/A	ISS
GO:0016763	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring pentosyl groups	SoyBase	N/A	ISS
PF01729	PFAM	Quinolinate phosphoribosyl transferase, C-terminal domain	JGI		ISS
UniRef100_B9SJ41	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nicotinate-nucleotide pyrophosphorylase [carboxylating], putative n=1 Tax=Ricinus communis RepID=B9SJ41_RICCO	SoyBase	E_val: 2.00E-36	ISS
UniRef100_I1KKR8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KKR8_SOYBN	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma07g23085

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g23085 not represented in the dataset	Glyma07g23085 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g23085 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g165500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g23085

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g23085

Limit To All Plant Sequences

>Glyma07g23085.1   sequence type=CDS   gene model=Glyma07g23085   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCTCATTTGTGTTTCAAGGTTTTTGTTTTTTTTTTCCGGGTTGAGACCAGGACTCTTGAGGAAGTGGAAGAAGTGTTACATTATTCATCTCAAACGAAGACTTCTTTGACTCGAATAATGTTGGACAATATGGTTGTGCCTCTACCAAATGGGGATTTGGACATATCTATGCTAAAAGAAGTTGTGCAGTTGATCAATGGGAGATATGAGACCGAGGCATTAGACAATGTCACACTAGATATTGTGCATAAAATTGGGCAAAGCAGAGTGACCTACATTTCTAGAGCAATGACTTTGGATTAG

Predicted protein sequences of Glyma07g23085

Limit To All Plant Sequences

>Glyma07g23085.1   sequence type=predicted peptide   gene model=Glyma07g23085   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSHLCFKVFVFFFRVETRTLEEVEEVLHYSSQTKTSLTRIMLDNMVVPLPNGDLDISMLKEVVQLINGRYETEALDNVTLDIVHKIGQSRVTYISRAMTLD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain