Glyma07g21440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g21440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g21440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g21440

Feature Type:	gene_model
Chromosome:	Gm07
Start:	22674857
stop:	22679219
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g21440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G30110	AT	Annotation by Michelle Graham. TAIR10: nudix hydrolase homolog 25 \| chr1:10582700-10583821 FORWARD LENGTH=175	SoyBase	E_val: 1.00E-99	ISS
GO:0006753	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside phosphate metabolic process	SoyBase	N/A	ISS
GO:0006857	GO-bp	Annotation by Michelle Graham. GO Biological Process: oligopeptide transport	SoyBase	N/A	ISS
GO:0015967	GO-bp	Annotation by Michelle Graham. GO Biological Process: diadenosine tetraphosphate catabolic process	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004081	GO-mf	Annotation by Michelle Graham. GO Molecular Function: bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity	SoyBase	N/A	ISS
GO:0008893	GO-mf	Annotation by Michelle Graham. GO Molecular Function: guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity	SoyBase	N/A	ISS
KOG2839	KOG	Diadenosine and diphosphoinositol polyphosphate phosphohydrolase	JGI		ISS
PTHR22769	Panther	MUTT/NUDIX HYDROLASE	JGI		ISS
PF00293	PFAM	NUDIX domain	JGI		ISS
UniRef100_C6SXU5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXU5_SOYBN	SoyBase	E_val: 1.00E-123	ISS
UniRef100_G7I948	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nudix hydrolase n=1 Tax=Medicago truncatula RepID=G7I948_MEDTR	SoyBase	E_val: 2.00E-114	ISS

Expression Patterns of Glyma07g21440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g21440 not represented in the dataset	Glyma07g21440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g21440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g165000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g21440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g21440

Limit To All Plant Sequences

>Glyma07g21440.1   sequence type=CDS   gene model=Glyma07g21440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTCTTCCCCAAGGTTACCGTCCCAACGTTGGTGTCTGTCTCATCAACTCCGATGATCAGATTTTTGTGGCTTCTAGGTTGAATGTCCCAGGAGCATGGCAAATGCCTCAGGGGGGAATTGAAGATGGTGAAGAACCCAAATCTGCTGCCATTAGGGAACTTCGAGAAGAAACTGGAATAGTATCTGCTGAGATAATTGCTGAGGTTCAGAAATGGTTGACATATGACTTCCCTCCTGCTGTGAAGGCTAAAGTCAATCGTCTGTGGGGAGGTGAATGGCATGGACAGGCGCAAAAGTGGTTTCTTATGAGATTAACAAAAGATGACAGTGAGGTCAACTTAACTAATGGGGAAGCAGAACCTGAATTTGCAGAATGGAAATGGGCAGACCCTGAAGAAGTTATTGAGCAGGCAGTGGACTACAAGAGACCAACTTATGAAGAGGTTATAAGAACCTTCAAGCCTTACTTTCAAGGGAGTGGAATATCTGCCAAATGTAAATCAACAAAGTGGTGA

Predicted protein sequences of Glyma07g21440

Limit To All Plant Sequences

>Glyma07g21440.1   sequence type=predicted peptide   gene model=Glyma07g21440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLPQGYRPNVGVCLINSDDQIFVASRLNVPGAWQMPQGGIEDGEEPKSAAIRELREETGIVSAEIIAEVQKWLTYDFPPAVKAKVNRLWGGEWHGQAQKWFLMRLTKDDSEVNLTNGEAEPEFAEWKWADPEEVIEQAVDYKRPTYEEVIRTFKPYFQGSGISAKCKSTKW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain