SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g21201): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g21201): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g21201

Feature Type:gene_model
Chromosome:Gm07
Start:21713455
stop:21714919
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G15900AT Annotation by Michelle Graham. TAIR10: Phox-associated domain;Phox-like;Sorting nexin, C-terminal | chr2:6927390-6932535 FORWARD LENGTH=994 SoyBaseE_val: 2.00E-79ISS
GO:0000956GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0035091GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol binding SoyBaseN/AISS
PTHR22999Panther PX SERINE/THREONINE KINASE (PXK) JGI ISS
PTHR22999:SF2Panther gb def: Hypothetical protein At2g15900 JGI ISS
PF02194PFAM PXA domain JGI ISS
UniRef100_G7JNK6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sorting nexin-16 n=1 Tax=Medicago truncatula RepID=G7JNK6_MEDTR SoyBaseE_val: 5.00E-81ISS
UniRef100_UPI000233D96AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D96A related cluster n=1 Tax=unknown RepID=UPI000233D96A SoyBaseE_val: 6.00E-107ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g21201 not represented in the dataset

Glyma07g21201 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g164200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g21201.1   sequence type=CDS   gene model=Glyma07g21201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCCTCTAACACCCACTTCAACAACAAATATCATCTATTATCTAATTGAAGAGGCCAAGCTCTATTTTCTACGGTGGGCTCTTTGTATATTCGCCATTTCCTATTTCTTCACTCAGAACAACACCAATAGTACCTTAGGAACTGCATCCAAGTTTTGTCCTTTTCCCACCTTGACTTATCTATCTCATTTGGAGAAAAATCAACTGCCACTGAATGACGGGCACCTCACTTATTCACCTCCCCCTCCCAAATGGAAGAAGAAGATTAATTCTCCTATTGTGGAGGCTGCCTTAAATGATTTTGTTGATTTGATATTGAAGGACTTTGTGATAAATATGTGGTATGCAAACATTACTCCAGATATGGAGTTTCCTGAGCTGGTACATGACTTAATCATGCATGCTATTGCTGAAGTGTCAGCAAGAGTTAAAGAGATAAACCTCGTTGACTTGCTCACAAGGGACATAGTTGATCTAATAGGTGATCACATAGACCTTTTCAGAAGAAATCAAGCTGCTATAGGTGTTGATGTTATGTTAACCTTATCTTCTGAGGAGAGGGATGGAAGATTGAAATTCTGTCTGTTGAATTCTAAGGAGCTTCATCTAGCACTAATGTCTCCAAAGAGTGAGTACAAGGTTCTTCGGCGGCTAATGAGAGGATTATTAGCTATGGTATTAAGAAAATGA

>Glyma07g21201.1   sequence type=predicted peptide   gene model=Glyma07g21201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGPLTPTSTTNIIYYLIEEAKLYFLRWALCIFAISYFFTQNNTNSTLGTASKFCPFPTLTYLSHLEKNQLPLNDGHLTYSPPPPKWKKKINSPIVEAALNDFVDLILKDFVINMWYANITPDMEFPELVHDLIMHAIAEVSARVKEINLVDLLTRDIVDLIGDHIDLFRRNQAAIGVDVMLTLSSEERDGRLKFCLLNSKELHLALMSPKSEYKVLRRLMRGLLAMVLRK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo