SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g21018): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g21018): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g21018

Feature Type:gene_model
Chromosome:Gm07
Start:21452281
stop:21452961
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g21018
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G04885AT Annotation by Michelle Graham. TAIR10: Glycosyl hydrolase family protein | chr5:1423369-1426628 FORWARD LENGTH=665 SoyBaseE_val: 2.00E-11ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
UniRef100_Q7XAS3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-D-glucosidase n=1 Tax=Gossypium hirsutum RepID=Q7XAS3_GOSHI SoyBaseE_val: 2.00E-11ISS
UniRef100_UPI00023391ECUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023391EC related cluster n=1 Tax=unknown RepID=UPI00023391EC SoyBaseE_val: 5.00E-64ISS

Expression Patterns of Glyma07g21018
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g21018 not represented in the dataset
Glyma07g21018 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g21018 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g162700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g21018
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g21018
>Glyma07g21018.1   sequence type=CDS   gene model=Glyma07g21018   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTACCTTTTACTATCATCAGAGTGCGCGTGTCTTTTTTTTTTCTTTTCTTCTTTTAACTATTGTTCAGGTGAGAAGGAAGCTCATAGAAGATTGGCTGCCGGTACTAGTTGTATGCAAAGATTGGCTCGCCAATGCTGTCGATATTGGTTCCATTCTTGACATGATGAACAAAGTTGCAGCTTGTGCTAAACACTATGTAGGAGATGATGGCACAACCAAGGGCATTAATGAGAACAATATTGTTGCCAGCTATAATGGATTGCTTCGAATTCACATTGGCTTATAG
Predicted protein sequences of Glyma07g21018
>Glyma07g21018.1   sequence type=predicted peptide   gene model=Glyma07g21018   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITFYYHQSARVFFFSFLLLTIVQVRRKLIEDWLPVLVVCKDWLANAVDIGSILDMMNKVAACAKHYVGDDGTTKGINENNIVASYNGLLRIHIGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo