|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G39050 | AT | Annotation by Michelle Graham. TAIR10: Kinesin motor family protein | chr4:18193462-18200148 FORWARD LENGTH=1055 | SoyBase | E_val: 5.00E-37 | ISS |
| GO:0007018 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule-based movement | SoyBase | N/A | ISS |
| GO:0031347 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of defense response | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003777 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: microtubule motor activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| KOG4172 | KOG | Predicted E3 ubiquitin ligase | JGI | ISS | |
| UniRef100_G7J7R5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Kinesin-like protein n=1 Tax=Medicago truncatula RepID=G7J7R5_MEDTR | SoyBase | E_val: 9.00E-39 | ISS |
| UniRef100_I1K734 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K734_SOYBN | SoyBase | E_val: 7.00E-40 | ISS |
|
Glyma07g19702 not represented in the dataset |
Glyma07g19702 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g159000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g19702.1 sequence type=CDS gene model=Glyma07g19702 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGGCATGTTGGCTAAATACAAAAAATCTCTGAAAGGACCAACTATCATTCAGGCGCGCATGCAAGAAATGAAGGAAAAAGAACTCAAGTACCTTGGAAATGGCGATGCCAATTCCCATGTTTGTAAAGTATGTTTTGAATCTCCAACTACAGTAATTCTGCTTTCATGCCGACATTTTTGTTTGTGTAAATCTTGTTCACTTGCTTGTTTTGAGGGTCCAATATGCCGCACAAGTATTACTGATAGGATTTTTGCTTTTACATAA
>Glyma07g19702.1 sequence type=predicted peptide gene model=Glyma07g19702 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAGMLAKYKKSLKGPTIIQARMQEMKEKELKYLGNGDANSHVCKVCFESPTTVILLSCRHFCLCKSCSLACFEGPICRTSITDRIFAFT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||