SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g19647): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g19647): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g19647

Feature Type:gene_model
Chromosome:Gm07
Start:19839461
stop:19842460
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g19647
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66060AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr5:26419481-26421118 FORWARD LENGTH=289 SoyBaseE_val: 4.00E-66ISS
GO:0018401GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline hydroxylation to 4-hydroxy-L-proline SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0031418GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ascorbic acid binding SoyBaseN/AISS
PTHR10869Panther PROLYL 4-HYDROXYLASE ALPHA SUBUNIT JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_C6TM81UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TM81_SOYBN SoyBaseE_val: 8.00E-68ISS
UniRef100_G7JYR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prolyl 4-hydroxylase alpha-2 subunit n=1 Tax=Medicago truncatula RepID=G7JYR0_MEDTR SoyBaseE_val: 1.00E-64ISS

Expression Patterns of Glyma07g19647
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g19647 not represented in the dataset
Glyma07g19647 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g19647 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g158900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g19647
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g19647
>Glyma07g19647.1   sequence type=CDS   gene model=Glyma07g19647   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCAGGAGGCGCTACTAAAGGTCTTCGATCGGATTCTTGATGTCGTTGTTGAGACCACTGGCACTGCTCCCTTCGATGAAATCATAGAGGTCAGAGTGCGTACAAGCTCTGGAACTTTTCTGGCCAGAGGTCATGATAAGATTGTTAGGGATATTGAGAAAAGAATTGCCGACTTTACTTTCATTCCCGTTGAGCATGGTGAAGGAATTCAAGTTCTGCATTATGAAGTTGGACAAAAGTATGAGCCTCACTATGACTACTATCTTAATGATTTTAACACTAAGAATAGGGGTCAGCGGGGTGAGACAGTGTTCCCAGATGCCAAAGGGAATTTAAGTTTTATGCCATGGTGGAATGAGCTTTCTGAGTGTCGAAAAAAAAAAAGACTTTCGATTAAACTGAAGAGGGTCGATGCTCTACTTTTTTGGAGCATGAAGCTAGATGCAACTTTAGATCCATCAAGCTTACATGGTTAG
Predicted protein sequences of Glyma07g19647
>Glyma07g19647.1   sequence type=predicted peptide   gene model=Glyma07g19647   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQEALLKVFDRILDVVVETTGTAPFDEIIEVRVRTSSGTFLARGHDKIVRDIEKRIADFTFIPVEHGEGIQVLHYEVGQKYEPHYDYYLNDFNTKNRGQRGETVFPDAKGNLSFMPWWNELSECRKKKRLSIKLKRVDALLFWSMKLDATLDPSSLHG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo