Glyma07g19360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g19360

Feature Type:	gene_model
Chromosome:	Gm07
Start:	19210387
stop:	19211464
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g19360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G58170	AT	Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein \| chr1:21536188-21536745 FORWARD LENGTH=185	SoyBase	E_val: 9.00E-74	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009807	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignan biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR21495	Panther	NUCLEOPORIN-RELATED	JGI		ISS
PF03018	PFAM	Dirigent-like protein	JGI		ISS
UniRef100_C6SWG8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWG8_SOYBN	SoyBase	E_val: 5.00E-114	ISS
UniRef100_G7KU38	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance response protein n=1 Tax=Medicago truncatula RepID=G7KU38_MEDTR	SoyBase	E_val: 1.00E-94	ISS

Expression Patterns of Glyma07g19360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g19360

Paralog	Evidence	Comments
Glyma18g43900	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g19360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g157100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g19360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g19360

Limit To All Plant Sequences

>Glyma07g19360.2   sequence type=CDS   gene model=Glyma07g19360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCACCCAATTCCTCATCTTCTCCCTCTTCTTCACTCCCTTCATCTTCACCGCAGCCCATGACACCCATGATTTTGTGCGCACCTTAGACCGCAAAATGTTGGGTTTGGACGAAAAGCAAGAAAAGCTCAGCCATTTCAGATTCTATTGGCATGACGTGGTGAGTGGACGCAACCCTTCTTCAATTGAAGTTGTGCCACCACCCTTGAAGAACTCAACCACATCCTTTGGATCGGTGAACATGATTGAGAACCCTTTGACATTAGAACCCCAATTGAACTCAAAATTGGTGGGGAAAGCTCAGGGGTTCTATGCTTCCACGTCACAAAGTGAAATCACCTTGCTCATGGCTATGAATTTCGCCATCACTGAAGGGAAGTACAATGGCAGCACCATCACAATTTTGGGGAGGAACTCTGTTTACGACAAGGAGAGAGAGATGCCCGTGATTGGTGGAAGTGGACTCTTTCGATTTGCTAGGGGATATGCTCAACTTAGAACGCATTGGTTCTCACCCACCACCAAGGATGCCATTGTTGAGTACAATATTTATGTTTTGCATTATTGA

Predicted protein sequences of Glyma07g19360

Limit To All Plant Sequences

>Glyma07g19360.2   sequence type=predicted peptide   gene model=Glyma07g19360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFTQFLIFSLFFTPFIFTAAHDTHDFVRTLDRKMLGLDEKQEKLSHFRFYWHDVVSGRNPSSIEVVPPPLKNSTTSFGSVNMIENPLTLEPQLNSKLVGKAQGFYASTSQSEITLLMAMNFAITEGKYNGSTITILGRNSVYDKEREMPVIGGSGLFRFARGYAQLRTHWFSPTTKDAIVEYNIYVLHY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain