SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g19230

Feature Type:gene_model
Chromosome:Gm07
Start:19117952
stop:19118989
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g19230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20090AT Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0041) | chr5:6787246-6788000 REVERSE LENGTH=110 SoyBaseE_val: 2.00E-63ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
KOG1590 KOG Uncharacterized conserved protein JGI ISS
PTHR14154Panther UPF0041 BRAIN PROTEIN 44-RELATED JGI ISS
PTHR14154:SF3Panther UNCHARACTERIZED JGI ISS
PF03650PFAM Uncharacterised protein family (UPF0041) JGI ISS
UniRef100_I1KKK7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KKK7_SOYBN SoyBaseE_val: 3.00E-64ISS
UniRef100_Q5XLE2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Brain protein 44-like n=1 Tax=Zea mays RepID=Q5XLE2_MAIZE SoyBaseE_val: 1.00E-57ISS

Expression Patterns of Glyma07g19230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g19230
ParalogEvidenceComments
Glyma18g43760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g19230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g156300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g19230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g19230
>Glyma07g19230.2   sequence type=CDS   gene model=Glyma07g19230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTAATTTCCGAGCATTCTTGAACAGTCCTGTTGGTCCAAAAACAACACATTTCTGGGGACCTATTGCCAATTGGGGATTTGTTGCTGCCGGTTTGATAGACATGAAAAAACCTCCAGAAATGATCTCTGGCAACATGACAGCAGTTATGTGCGTCTATTCAGCATTGTTCATGAGATTTGCATGGATGGTTCAACCGCGAAACTATCTGCTTCTTGCTTGCCATGCATCCAACGAGGCCGTACAAATACGCCAACTCACCCGTTGGGCAAAGGGGAATGGGTACCTTTCTGTGAAGAAGGAAGGAGCTTCGTCCAAGTAA
Predicted protein sequences of Glyma07g19230
>Glyma07g19230.2   sequence type=predicted peptide   gene model=Glyma07g19230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNFRAFLNSPVGPKTTHFWGPIANWGFVAAGLIDMKKPPEMISGNMTAVMCVYSALFMRFAWMVQPRNYLLLACHASNEAVQIRQLTRWAKGNGYLSVKKEGASSK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo