SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g19190

Feature Type:gene_model
Chromosome:Gm07
Start:19088041
stop:19090387
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g19190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18880AT Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein | chr3:6509588-6510069 FORWARD LENGTH=105 SoyBaseE_val: 4.00E-46ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1740 KOG Predicted mitochondrial/chloroplast ribosomal protein S17 JGI ISS
PTHR10744Panther 40S RIBOSOMAL PROTEIN S11 FAMILY MEMBER JGI ISS
PF00366PFAM Ribosomal protein S17 JGI ISS
UniRef100_G7JKN8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S17 n=2 Tax=Medicago truncatula RepID=G7JKN8_MEDTR SoyBaseE_val: 1.00E-55ISS
UniRef100_I1KKK3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKK3_SOYBN SoyBaseE_val: 1.00E-66ISS

Expression Patterns of Glyma07g19190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g19190
ParalogEvidenceComments
Glyma18g43721 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g19190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g155900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g19190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g19190
>Glyma07g19190.1   sequence type=CDS   gene model=Glyma07g19190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAAGTAGTAGGAATGGTGGTTTCCAATAAGATGCAGAAATCAGTTGTGGTGGCAGTGGATAGACTTTTCTATCACAAAGTCTATGATCGTTATGTCAAGCGCACCTCTAAATTCATGGCTCACGATGAGAACAACCTCTGTAACATTGGTGACAAAGTTCGACTGGATCCTTCTAGACCTTTGAGCAAGCATAAACATTGGGTTGTTGCTGAAATTCTTAAGAAGGCACAGATATACGTTCCACCCTCCACCCCTGTGTCTGTTAATGTCAACTCCAGCTCTGTAGCACCAGCTTCATAA
Predicted protein sequences of Glyma07g19190
>Glyma07g19190.1   sequence type=predicted peptide   gene model=Glyma07g19190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQVVGMVVSNKMQKSVVVAVDRLFYHKVYDRYVKRTSKFMAHDENNLCNIGDKVRLDPSRPLSKHKHWVVAEILKKAQIYVPPSTPVSVNVNSSSVAPAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo