SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g18957

Feature Type:gene_model
Chromosome:Gm07
Start:18903652
stop:18905897
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g18957
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08880AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G01570.1); Has 177 Blast hits to 175 proteins in 60 species: Archae - 4; Bacteria - 33; Metazoa - 18; Fungi - 11; Plants - 59; Viruses - 0; Other Eukaryotes - 52 (source: NCBI BLink). | chr3:2703169-2704165 FORWARD LENGTH=201 SoyBaseE_val: 3.00E-40ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KKI8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1KKI8_SOYBN SoyBaseE_val: 2.00E-67ISS
UniRef100_Q01J37UniRef Annotation by Michelle Graham. Most informative UniRef hit: OSIGBa0140O07.6 protein n=4 Tax=Oryza sativa RepID=Q01J37_ORYSA SoyBaseE_val: 9.00E-29ISS

Expression Patterns of Glyma07g18957
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g18957 not represented in the dataset
Glyma07g18957 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g18957
ParalogEvidenceComments
Glyma18g43591 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g18957 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g18957
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g18957
>Glyma07g18957.1   sequence type=CDS   gene model=Glyma07g18957   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAACCTTGGAGAAACATCGACGTGGAAAAGCTGATCTCGTACAGTGACGACCTCGTCAAGGTATTGTCGCAGGGTCCGCGCGACTTCAACAACCTCTCCCACTCTCTCCAACAAAAGCTCGCCCTTTCTTCCTCCTGCGACTCCGACCTCGACGATGTTCGCTCTTCTCTCCAAGACTATCAGAAAAAGGTAGATACATGCAAGCAGAAAATAGAGGAAGCTAGATCCGAGACTGCTGCTGATGCAGACCTGGATCTGCTACAGAGAGAACTGGAGGAAGAACTTGAGAAAGAACACTTGTTGAAAGAGGAGATGGTACTTTCAATGTATGCTTCTGTCACAAATATTGTGCCTAACTTGGATGAACATTCCAAAATTTCAGGCTATATTGTGGAAAAGGATAAAGATGCTGTTGAGAAGTTTGAATATGACACCTCAAAGATGACTGCCCTTGATATATGTAATGGTATTTGGAAAATAATAAGTGAATGA
Predicted protein sequences of Glyma07g18957
>Glyma07g18957.1   sequence type=predicted peptide   gene model=Glyma07g18957   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEPWRNIDVEKLISYSDDLVKVLSQGPRDFNNLSHSLQQKLALSSSCDSDLDDVRSSLQDYQKKVDTCKQKIEEARSETAADADLDLLQRELEEELEKEHLLKEEMVLSMYASVTNIVPNLDEHSKISGYIVEKDKDAVEKFEYDTSKMTALDICNGIWKIISE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo