SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g18491): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g18491): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g18491

Feature Type:gene_model
Chromosome:Gm07
Start:18429864
stop:18432152
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35500AT Annotation by Michelle Graham. TAIR10: shikimate kinase like 2 | chr2:14914038-14915909 FORWARD LENGTH=387 SoyBaseE_val: 1.00E-48ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009069GO-bp Annotation by Michelle Graham. GO Biological Process: serine family amino acid metabolic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004765GO-mf Annotation by Michelle Graham. GO Molecular Function: shikimate kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR12526Panther GLYCOSYLTRANSFERASE JGI ISS
PTHR12526:SF27Panther SUCROSE SYNTHASE JGI ISS
PF00862PFAM Sucrose synthase JGI ISS
UniRef100_G7KCE4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Shikimate kinase-like protein n=1 Tax=Medicago truncatula RepID=G7KCE4_MEDTR SoyBaseE_val: 6.00E-74ISS
UniRef100_I1KKH0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKH0_SOYBN SoyBaseE_val: 9.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g18491 not represented in the dataset

Glyma07g18491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g152600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g18491.1   sequence type=CDS   gene model=Glyma07g18491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTAAGATTAAACATAGGAGGTTTGGATGTCCGAAGCTCTAGAGATATATCGGTTGATACAAATGATACCTCTTTAGCTATCATTCTGCGGCCAGGATCTCCCATCACACTCATAGAAACTAATCCTCTTTTTGATAGGGTTAAATCCTCCGAAACAATATGGTATATAGATGATGATCAACTTGTTGTGAACTTCAAGAAACAGGACCCTGATTTGAGATGGCCTGACATCATGGAGTCCTGGGAATCACTTATTGCAGGATCTCCACAACTTTTGGAAGGGACATCCATCTATCTTGTTGGTGATTCAACCGAAATCAATCAAAAAGGGGGCCCGAAAGCTAGCAACTGGTACACTCCACTGAGCACGAAAGAGTTACTGGAATTATATACTAAGCAGACTGTGGATTTATGGCTGCTTGCTGAAGGCTCTAACTTAGTACCAGAAGCAGAAAGTGTTGTACTTGAAAGCATAAGTATTAATCAAATTCACATTTACGTGAAGCTTCCAAATATGTTCAACATAGTTATCCTCTGTATTCGTGGATACTTTGGCCAAGCAGCTGTCCTAGGATTGCCAGACACCGGAGGCCAGGTGGTATATATTCTTGATCAAGTAAGGGCCTTAGAGGAAGAGCTACTCCATAAGATTGAGCTGCAAGGCCTTGACGTGAAGCCTCAGATTCTTGTGAGGCTTTAA

>Glyma07g18491.1   sequence type=predicted peptide   gene model=Glyma07g18491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELRLNIGGLDVRSSRDISVDTNDTSLAIILRPGSPITLIETNPLFDRVKSSETIWYIDDDQLVVNFKKQDPDLRWPDIMESWESLIAGSPQLLEGTSIYLVGDSTEINQKGGPKASNWYTPLSTKELLELYTKQTVDLWLLAEGSNLVPEAESVVLESISINQIHIYVKLPNMFNIVILCIRGYFGQAAVLGLPDTGGQVVYILDQVRALEEELLHKIELQGLDVKPQILVRL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo