Glyma07g18140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g18140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g18140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g18140

Feature Type:	gene_model
Chromosome:	Gm07
Start:	17883193
stop:	17888589
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g18140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G01500	AT	Annotation by Michelle Graham. TAIR10: thylakoid ATP/ADP carrier \| chr5:199017-201329 FORWARD LENGTH=415	SoyBase	E_val: 4.00E-178	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0010117	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoprotection	SoyBase	N/A	ISS
GO:0010206	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II repair	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009526	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid envelope	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0042651	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005347	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP transmembrane transporter activity	SoyBase	N/A	ISS
KOG0752	KOG	Mitochondrial solute carrier protein	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF87	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_G7KS97	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid ADP,ATP carrier protein n=1 Tax=Medicago truncatula RepID=G7KS97_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1KKE2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKE2_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma07g18140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g18140 not represented in the dataset	Glyma07g18140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g18140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g149500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g18140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g18140

Limit To All Plant Sequences

>Glyma07g18140.1   sequence type=CDS   gene model=Glyma07g18140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTATTTCCGCGTCCCCCACAGAGGAGAGAGCCACACTCTCGTGGCGCAAAATTCCCCACTTCAAATACGACGCCGTTCAGCCCCGCCTCCGTCGCAACACCACCACCACCCTCACTTTCGCCACCGCCACCGGCGGCTCTAAATTCGCCTCCGTCTCCGTGGCGGAGCCCAAACTGCACCACGATTTCATGCCCACGCCGTCCCAGCTCTTCAAGAACCCCCTCGCCGCCTTCGCCATCGTGCCCCGTGACGCCGCTCTCTTCTCCGCCGGAGCCATCGCCGGCGCCGCCGCCAAGACCGTCACCGCGCCGCTCGACCGCATCAAGCTCCTCATGCAGACTCATGGTGTGCGTCTTGGGCAAGATAGTGCTAAGAAGGCAATAAGTTTCATTGAGGCCATAGCAGTTATAGGGAAAGAAGAAGGTATTCAAGGTTACTGGAAGGGCAACCTCCCTCAGGTGATTCGAGTTGTACCTTACAGTGCTGTCCAGCTTTTTGCTTATGAAATTTATAAGAAAATATTCAAGGGAGAGAATGGCGAGCTCTCTGTTGCAGGAAGACTTGCAGCAGGTGCTTTTGCTGGAATGACATCCACTTTTATAACTTACCCATTAGACGTTCTAAGATTGCGATTAGCTGTTGAACCTGGTTATCGGACCATGTCAGAGGTTGCCTTAAGCATGCTAAGGGAGGAAGGATTTGCATCTTTCTATCGTGGCCTTGGGCCTTCTCTAATTGCAATAGCTCCTTATATTGCAGTGAACTTTTGTGTTTTTGACTTATTGAAGAAGTCATTGCCTGAGAAATATCAAAAGCGAACTGAAACATCTATACTCACAGCTGTCCTTTCGGCATCTCTTGCTACACTTACATGCTATCCTCTGGACACTGTGCGAAGACAGATGCAATTGAAGGGCACACCTTATAAGACAGTATTAGATGCTCTTTCAGGTATTGTGGCACGAGATGGGGTTGCTGGTTTGTATCGGGGATTTGTGCCCAATGCTCTAAAATCCCTTCCTAACAGCAGCATCAAGCTTACCACATATGACATTGTTAAGCGCCTAATTTCTGCTAGCGAGAAAGAATTTCAAACAATTGCAGAGGAAAATCGCATCAAACACAAGAACACTAACAATCAATGA

Predicted protein sequences of Glyma07g18140

Limit To All Plant Sequences

>Glyma07g18140.1   sequence type=predicted peptide   gene model=Glyma07g18140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPISASPTEERATLSWRKIPHFKYDAVQPRLRRNTTTTLTFATATGGSKFASVSVAEPKLHHDFMPTPSQLFKNPLAAFAIVPRDAALFSAGAIAGAAAKTVTAPLDRIKLLMQTHGVRLGQDSAKKAISFIEAIAVIGKEEGIQGYWKGNLPQVIRVVPYSAVQLFAYEIYKKIFKGENGELSVAGRLAAGAFAGMTSTFITYPLDVLRLRLAVEPGYRTMSEVALSMLREEGFASFYRGLGPSLIAIAPYIAVNFCVFDLLKKSLPEKYQKRTETSILTAVLSASLATLTCYPLDTVRRQMQLKGTPYKTVLDALSGIVARDGVAGLYRGFVPNALKSLPNSSIKLTTYDIVKRLISASEKEFQTIAEENRIKHKNTNNQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain