SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g17992): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g17992): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g17992

Feature Type:gene_model
Chromosome:Gm07
Start:17764935
stop:17766099
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56650AT Annotation by Michelle Graham. TAIR10: Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein | chr3:20984807-20985913 FORWARD LENGTH=262 SoyBaseE_val: 3.00E-40ISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0019898GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF01789PFAM PsbP JGI ISS
UniRef100_B9SJN0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 29.8 kDa protein, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9SJN0_RICCO SoyBaseE_val: 8.00E-42ISS
UniRef100_UPI0002338EFEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338EFE related cluster n=1 Tax=unknown RepID=UPI0002338EFE SoyBaseE_val: 5.00E-56ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g17992 not represented in the dataset

Glyma07g17992 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g148400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g17992.1   sequence type=CDS   gene model=Glyma07g17992   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGCTTCTCTTGGACCATTTGTCATTGAAAACACTTTTGATCCTGAAGAGCTCCTTGAGACTTCAGTTGAAAAGCTTTGTGATCAGACATACTACAAATACGTGCTCGAAACACCATATGCTCTAACAGGCACACACAATCTTGCAAAAGCAACAACAAAGGGAAACACTGTTGTTTTGTTTGTAGTTAGTGCCAATGACAAGCAGTGGCAAACTTCTAAGGAGACTCTAAAAGTCGTGCTTAATTCCTTTGAAGTTTAG

>Glyma07g17992.1   sequence type=predicted peptide   gene model=Glyma07g17992   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIASLGPFVIENTFDPEELLETSVEKLCDQTYYKYVLETPYALTGTHNLAKATTKGNTVVLFVVSANDKQWQTSKETLKVVLNSFEV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo