|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G56650 | AT | Annotation by Michelle Graham. TAIR10: Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein | chr3:20984807-20985913 FORWARD LENGTH=262 | SoyBase | E_val: 3.00E-40 | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009523 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009543 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009654 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex | SoyBase | N/A | ISS |
| GO:0019898 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane | SoyBase | N/A | ISS |
| GO:0031977 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen | SoyBase | N/A | ISS |
| GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PF01789 | PFAM | PsbP | JGI | ISS | |
| UniRef100_B9SJN0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 29.8 kDa protein, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9SJN0_RICCO | SoyBase | E_val: 8.00E-42 | ISS |
| UniRef100_UPI0002338EFE | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002338EFE related cluster n=1 Tax=unknown RepID=UPI0002338EFE | SoyBase | E_val: 5.00E-56 | ISS |
|
Glyma07g17992 not represented in the dataset |
Glyma07g17992 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g148400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g17992.1 sequence type=CDS gene model=Glyma07g17992 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATTGCTTCTCTTGGACCATTTGTCATTGAAAACACTTTTGATCCTGAAGAGCTCCTTGAGACTTCAGTTGAAAAGCTTTGTGATCAGACATACTACAAATACGTGCTCGAAACACCATATGCTCTAACAGGCACACACAATCTTGCAAAAGCAACAACAAAGGGAAACACTGTTGTTTTGTTTGTAGTTAGTGCCAATGACAAGCAGTGGCAAACTTCTAAGGAGACTCTAAAAGTCGTGCTTAATTCCTTTGAAGTTTAG
>Glyma07g17992.1 sequence type=predicted peptide gene model=Glyma07g17992 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIASLGPFVIENTFDPEELLETSVEKLCDQTYYKYVLETPYALTGTHNLAKATTKGNTVVLFVVSANDKQWQTSKETLKVVLNSFEV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||