SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g17895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g17895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g17895

Feature Type:gene_model
Chromosome:Gm07
Start:17682483
stop:17683986
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g17895
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76900AT Annotation by Michelle Graham. TAIR10: tubby like protein 1 | chr1:28882741-28884377 FORWARD LENGTH=455 SoyBaseE_val: 6.00E-75ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0043687GO-bp Annotation by Michelle Graham. GO Biological Process: post-translational protein modification SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008081GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoric diester hydrolase activity SoyBaseN/AISS
PTHR16517Panther TUBBY-RELATED JGI ISS
PTHR16517:SF7Panther TUBBY-LIKE PROTEIN JGI ISS
PF00646PFAM F-box domain JGI ISS
PF01167PFAM Tub family JGI ISS
UniRef100_G7ICY3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tubby-like F-box protein n=1 Tax=Medicago truncatula RepID=G7ICY3_MEDTR SoyBaseE_val: 7.00E-95ISS
UniRef100_I1KKC2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKC2_SOYBN SoyBaseE_val: 2.00E-109ISS

Expression Patterns of Glyma07g17895
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g17895 not represented in the dataset
Glyma07g17895 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g17895 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g147700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g17895
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g17895
>Glyma07g17895.1   sequence type=CDS   gene model=Glyma07g17895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAGTTCAGTCCACGAGTTGCAGGATCAGCCACCGGTTATACAGAACAGCCGGTGGGCTAGCCTTCTTCTGGAGCTTCTTCGTGATGTTATTAATAGATTGGAAGCAAGCGAGAGTACATGGCCTGGTTGTAAGCATGTGGTTGCATGTGCTGCCATGTGCAAGTCCTGGAGAGAAATGTGCAAAGAAATTGTCAGCAGTCCTGAATTCTGTGGGAAGATTACTTTCCCTGTTTCCTTGAAGCAGCCTGGGCATAGGGATGGACCCATTCAGTGTTTCATCAAGAGAGACAAATCTAAGCTGACATACCACCTCTTCCTTTGCCTTAGTCCTGTCTTGCTTGTTGAAAATGGAAAGTTTCTTCTCTCTGCAAAACGGACAAGAAGAACAACTTGCACAAAGTATATTATATCAATGAATGCAGATAACATATCAAGATCTAGTAGTACTTACATTGGAAAACTGAGGATAAATGGCTTCCTCTCCACACTCTTGCTGCATGTGGAGAATTTTACCTTTTAG
Predicted protein sequences of Glyma07g17895
>Glyma07g17895.1   sequence type=predicted peptide   gene model=Glyma07g17895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSSVHELQDQPPVIQNSRWASLLLELLRDVINRLEASESTWPGCKHVVACAAMCKSWREMCKEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPVLLVENGKFLLSAKRTRRTTCTKYIISMNADNISRSSSTYIGKLRINGFLSTLLLHVENFTF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo