Glyma07g17250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g17250

Feature Type:	gene_model
Chromosome:	Gm07
Start:	16973924
stop:	16975027
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g17250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G13870	AT	Annotation by Michelle Graham. TAIR10: Werner syndrome-like exonuclease \| chr4:8023563-8025542 REVERSE LENGTH=285	SoyBase	E_val: 2.00E-26	ISS
GO:0006139	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008408	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity	SoyBase	N/A	ISS
PTHR13620	Panther	3-5 EXONUCLEASE	JGI		ISS
PF01612	PFAM	3'-5' exonuclease	JGI		ISS
UniRef100_E5GBP0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 3'-5' exonuclease n=1 Tax=Cucumis melo subsp. melo RepID=E5GBP0_CUCME	SoyBase	E_val: 5.00E-73	ISS
UniRef100_I1KK90	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KK90_SOYBN	SoyBase	E_val: 2.00E-174	ISS

Expression Patterns of Glyma07g17250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g17250

Paralog	Evidence	Comments
Glyma18g42051	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g17250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g143200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g17250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g17250

Limit To All Plant Sequences

>Glyma07g17250.1   sequence type=CDS   gene model=Glyma07g17250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATCATCGCGGCAAGACCAAACCGGCGCGCCGCGCAGCTCCTCCACCACCACCACCACGCCCGTGGTGGCGCCGATCAGCGTGGTGGACCACGGCCTCCCCTACGACACCCACAACCTCTACGACGTCTCCTTCAACAACACCCACACCATCTACACCCTCCTCACCTCCGACCCCTCCCTCGTCGACTCCTGGATCTCCACCGTCCTCCGCGACCACCAGCACCAGCACCAGCAGCGCGTCCTCACCGTGGGCCTCGACATCGAGTGGCGCCCCAACACCCAGCGCAACATGCAGAACCCCGTGGCCACACTCCAGCTCTGCGTCGCCGAACGCTGCCTCGTCTTCCAGATTCTCCACTCCCCTTCAATCCCTCCCTCTCTTGTTTCCTTCCTCGCTGACCCTAACATCACTTTCGTTGGTGTTGGGATCCAAGAAGACATGGAGAAGCTTCTAGAAGATTATAATCTTAACGTGGCGAATGTTCGTGACCTTCGCTCCTTCGCTGCGGAGAGGCTTGGCGACCTTGAGCTGAAACGGGCCGGGCTCAAGTCTTTGGGCCTCCGCGTGCTGGGCCTGGAAGTTGCCAAGCCCAAGCGGGTCACCAGGAGTAGGTGGGACAATCCCTGGCTCACTGCCCAGCAGGTTCAGTATGCCGCCGTTGATGCCTTTCTCTCTTACGAGATTGATCGCCGTTTGAGTTCTTATAATTAA

Predicted protein sequences of Glyma07g17250

Limit To All Plant Sequences

>Glyma07g17250.1   sequence type=predicted peptide   gene model=Glyma07g17250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MISSRQDQTGAPRSSSTTTTTPVVAPISVVDHGLPYDTHNLYDVSFNNTHTIYTLLTSDPSLVDSWISTVLRDHQHQHQQRVLTVGLDIEWRPNTQRNMQNPVATLQLCVAERCLVFQILHSPSIPPSLVSFLADPNITFVGVGIQEDMEKLLEDYNLNVANVRDLRSFAAERLGDLELKRAGLKSLGLRVLGLEVAKPKRVTRSRWDNPWLTAQQVQYAAVDAFLSYEIDRRLSSYN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain