Report for Sequence Feature Glyma07g16760
Feature Type: gene_model
Chromosome: Gm07
Start: 16457461
stop: 16460206
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g16760
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G02020 AT
Annotation by Michelle Graham. TAIR10: Encodes a protein involved in salt tolerance, names SIS (Salt Induced Serine rich). | chr5:386557-387921 REVERSE LENGTH=149
SoyBase E_val: 3.00E-24 ISS
GO:0006914 GO-bp
Annotation by Michelle Graham. GO Biological Process: autophagy
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1KK51 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KK51_SOYBN
SoyBase E_val: 1.00E-101 ISS
UniRef100_Q9LZM9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT5g02020/T7H20_70 n=1 Tax=Arabidopsis thaliana RepID=Q9LZM9_ARATH
SoyBase E_val: 2.00E-21 ISS
Expression Patterns of Glyma07g16760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g16760
Paralog Evidence Comments
Glyma18g41310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g16760 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g139300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g16760
Coding sequences of Glyma07g16760
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g16760.1 sequence type=CDS gene model=Glyma07g16760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGGAAGGAAAAAAATGGGTTCTTCTTCTTTCACTTCTGAGCTCTTTGGATCCAACCAGTTCCAGAAATCTGCTGCTTCTGGAATTTTTGAATCTATGTTTCCTCCACCGTCTAAGGTGTTAGGGAGAGAGTCTCTGCGTTCTGAAGTGTGTGAGAAAACTGCCAATGAGAGGTGGAGCTCCAAAATTGATTACATCAGCAAGGGAAGTGATGGTGAAACTCAGAGCACGACACATAAGGATATGAGTTCTATCTATCAGGAACAAAGACTTCAACCATGTCAACTTAGCTCATCAATCCATTATGGTGGCCAGGACATATGTTCTTGTCCCAAGAGTACACAAGATTCAGGATACAACTCTTTGCTGTACAAGAAAGATGGGGTTGAAGATGATTTAGGAAGTAACCTGTGGCAAGGGGGTCCCTATTATTAA
Predicted protein sequences of Glyma07g16760
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g16760.1 sequence type=predicted peptide gene model=Glyma07g16760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGRKKMGSSSFTSELFGSNQFQKSAASGIFESMFPPPSKVLGRESLRSEVCEKTANERWSSKIDYISKGSDGETQSTTHKDMSSIYQEQRLQPCQLSSSIHYGGQDICSCPKSTQDSGYNSLLYKKDGVEDDLGSNLWQGGPYY*