|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G36180 | AT | Annotation by Michelle Graham. TAIR10: acetyl-CoA carboxylase 2 | chr1:13546047-13558339 FORWARD LENGTH=2355 | SoyBase | E_val: 1.00E-47 | ISS |
| GO:0006633 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0003989 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: acetyl-CoA carboxylase activity | SoyBase | N/A | ISS |
| GO:0004075 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: biotin carboxylase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016874 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ligase activity | SoyBase | N/A | ISS |
| GO:0046872 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: metal ion binding | SoyBase | N/A | ISS |
| PF08326 | PFAM | Acetyl-CoA carboxylase, central region | JGI | ISS | |
| UniRef100_G8A394 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Acetyl-CoA carboxylase n=1 Tax=Medicago truncatula RepID=G8A394_MEDTR | SoyBase | E_val: 1.00E-50 | ISS |
| UniRef100_UPI0002338528 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002338528 related cluster n=1 Tax=unknown RepID=UPI0002338528 | SoyBase | E_val: 2.00E-58 | ISS |
|
Glyma07g16521 not represented in the dataset |
Glyma07g16521 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g137400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g16521.1 sequence type=CDS gene model=Glyma07g16521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAATGTGCATGCCTCTTCTTTCGCCTGCATCTGGGATTATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGCTGGTGAACTTATAGCAAGGCTTCATCTGGATGATCCTTCAACTGTAAGAAAGGCAGAACCCTTCACTGGGAGCTTCCCAGTTCTGGGACCTCCTACTGCAATTTCTGGTAAAGTTCATCAGAAATGCGCTGCAAGCTTAAATGCCGCACGGATGATTCTTTCTGGGTATGACCACAATATTGATGAAGGAATCAAGAGTAAAAATAAGTTGATCTTGCAACTGATGGATAAATTGGTATAA
>Glyma07g16521.1 sequence type=predicted peptide gene model=Glyma07g16521 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKMCMPLLSPASGIIHFKMSEGQAMQAGELIARLHLDDPSTVRKAEPFTGSFPVLGPPTAISGKVHQKCAASLNAARMILSGYDHNIDEGIKSKNKLILQLMDKLV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||