Glyma07g16490 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g16490

Feature Type:	gene_model
Chromosome:	Gm07
Start:	16182787
stop:	16185748
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g16490

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G02050	AT	Annotation by Michelle Graham. TAIR10: Mitochondrial glycoprotein family protein \| chr5:403239-404244 REVERSE LENGTH=267	SoyBase	E_val: 1.00E-65	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005759	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix	SoyBase	N/A	ISS
KOG2536	KOG	MAM33, mitochondrial matrix glycoprotein	JGI		ISS
PTHR10826	Panther	COMPLEMENT COMPONENT 1	JGI		ISS
PTHR10826:SF1	Panther	COMPLEMENT COMPONENT 1, Q SUBCOMPONENT BINDING PROTEIN RELATED	JGI		ISS
PF02330	PFAM	Mitochondrial glycoprotein	JGI		ISS
UniRef100_D7M774	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial glycoprotein family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M774_ARALL	SoyBase	E_val: 8.00E-72	ISS
UniRef100_I1KK35	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KK35_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma07g16490

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g16490

Paralog	Evidence	Comments
Glyma18g40750	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g16490 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g137100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g16490

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g16490

Limit To All Plant Sequences

>Glyma07g16490.1   sequence type=CDS   gene model=Glyma07g16490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGTACGCGATGCTTCGCCGCGTCTCCTCCGCCGTGCTGCCTCAGCTGGCGCGCCGCACGGCCATGGCATCGTCTTCTTCCAGAACCTTCCACATTGCTCTCTCTGTTCTCCGCAGAGAGACAGCGACTACTACTATCGCACCCTCTCTTCGCTTCGCCAACGCCTTCGCTACCAAGTCCAGCGCCGACGAATATCTCGCTCAAGTGCTTCAGTCTGAGATCCAATGCGCCCTCGAAGACGACCATGCCCACCACCAAGTCGAAGTTCCTGTTGATTTTCCTTTTGACATTGAGGACAATCCTGGAGAAAGAACCATACAACTAAAAGGAAAATTTGGAGATGAAACTATCAAAGTTCAAGTTGACATCCCTAATGTAGCACCTGGAGAAGAAAATGAGGATGACGAAAATGGTGACAATGAGAAGAATGATAGTGAATCTAGCATTCCTTTAGTTGTGAGTGTTTTCAAAGAAAATGGAGTGTCTCTAGAGTTTGGTGTGACTGCTTTTCCCGATGAGATTTCCATTGATAGCTTGTCAATAAAGCAGTGTGAGGAATCTGAAGACCAGTTGGCATACGAGGGGCCTGAGTTCATTGATTTGGATGAAAATCTGCAAAAGGCTTTTCACAAGTATCTTGAGATCAGGGGAATCAAGCCTAGCACAACCAATTTCTTGCAGGAATACATGTTTGCTAAAGACAACAAGGAATATTTGATGTGGCTGAAGAACCTGAAGAACTTCGTCGAGAAATGA

Predicted protein sequences of Glyma07g16490

Limit To All Plant Sequences

>Glyma07g16490.1   sequence type=predicted peptide   gene model=Glyma07g16490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMYAMLRRVSSAVLPQLARRTAMASSSSRTFHIALSVLRRETATTTIAPSLRFANAFATKSSADEYLAQVLQSEIQCALEDDHAHHQVEVPVDFPFDIEDNPGERTIQLKGKFGDETIKVQVDIPNVAPGEENEDDENGDNEKNDSESSIPLVVSVFKENGVSLEFGVTAFPDEISIDSLSIKQCEESEDQLAYEGPEFIDLDENLQKAFHKYLEIRGIKPSTTNFLQEYMFAKDNKEYLMWLKNLKNFVEK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain