SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g15960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g15960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g15960

Feature Type:gene_model
Chromosome:Gm07
Start:15688928
stop:15694975
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37660AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr2:15795481-15796977 REVERSE LENGTH=325 SoyBaseE_val: 1.00E-155ISS
GO:0000272GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006694GO-bp Annotation by Michelle Graham. GO Biological Process: steroid biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003854GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-beta-hydroxy-delta5-steroid dehydrogenase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
KOG1203 KOG Predicted dehydrogenase JGI ISS
PTHR14194Panther NITROGEN METABOLIC REGULATION PROTEIN NMR-RELATED JGI ISS
PTHR14194:SF17Panther SUBFAMILY NOT NAMED JGI ISS
PF01073PFAM 3-beta hydroxysteroid dehydrogenase/isomerase family JGI ISS
UniRef100_B6T962UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD-dependent epimerase/dehydratase n=1 Tax=Zea mays RepID=B6T962_MAIZE SoyBaseE_val: 2.00E-152ISS
UniRef100_C6THR8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6THR8_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g15960 not represented in the dataset

Glyma07g15960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g39933 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g133200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g15960.1   sequence type=CDS   gene model=Glyma07g15960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACACGTGTCCCTTTTGTTTTGTGCGCAGCCACCACTTCTCCCAACCACTGCCTTAAATACTGCGTGGTGGCACCGTCACTTCCTCTACCGGTTTCTTCCTCCTCATTAAGCCGCCACTTTCTCTCTCTTTCCTTTTCGTCTTCTTTTTCTTCTTCGTTGGGTTTGTTGCCACTTAGTAAGAAAGAGGGTGTGAAGAGAGTGGGGAGAAGATTTGGTGTTGTGGCCATGGCGGAGTCTAAGAGTACTGTGCTTGTTACGGGAGCGGGTGGTCGCACAGGACAAATAGTTTACAAAAAATTAAGAGAGAGGCCAAACCAATATGTGGCTAGAGGTCTGGTTAGAACAGATGAAAGCAAACAGAACATTGGTGCTGCAGATGACGTTATTGTTGGGGATATAAGAGATGCTGAAAGTATTGTTCCTGCAATTCAAGGTATAGATGCCCTCATAATCCTCACAAGTGCAGTTCCACAGATAAAGCCTGGTTTTGATCCAACCAAAGGACAAAGACCAGAGTTCTATTTTGAGGATGGGGCATATCCTGAACAGGTTGACTGGATTGGGCAGAAAAATCAAATAGATGTCGCCAAGGCTGCTGGAGTGAAGCACATTGTGTTAGTAGGGTCTATGGGTGGAACGGACCTTAACCATCCTTTGAACAGCTTGGGTAATGGGAATATATTGGTTTGGAAAAGGAAGGCTGAGCAATATCTGGCTGATTCCGGCATCCCATATACAATTATAAGGGCTGGTGGCTTGCAAGACAAAGATGGAGGTCTTCGGGAACTACTTGTAGGGAAGGATGATGAGCTTCTCCAGACTGAAACCAGAACCATAAGTAGATCTGATGTTGCAGAAGTCTGCATTCAGGCACTAAATTTTGAGGAGGCTAAATTCAAGGCATTTGACTTGGCATCAAAACCTGAGGGAGCAGGTTCAGCAACAAAGGATTTCAAGGCTTTATTTTCCCAGATCACCACTCGCTTTTGA

>Glyma07g15960.1   sequence type=predicted peptide   gene model=Glyma07g15960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATRVPFVLCAATTSPNHCLKYCVVAPSLPLPVSSSSLSRHFLSLSFSSSFSSSLGLLPLSKKEGVKRVGRRFGVVAMAESKSTVLVTGAGGRTGQIVYKKLRERPNQYVARGLVRTDESKQNIGAADDVIVGDIRDAESIVPAIQGIDALIILTSAVPQIKPGFDPTKGQRPEFYFEDGAYPEQVDWIGQKNQIDVAKAAGVKHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGLRELLVGKDDELLQTETRTISRSDVAEVCIQALNFEEAKFKAFDLASKPEGAGSATKDFKALFSQITTRF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo