SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g15710

Feature Type:gene_model
Chromosome:Gm07
Start:15434362
stop:15435970
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g15710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28610AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr2:12262115-12263286 FORWARD LENGTH=244 SoyBaseE_val: 1.00E-31ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009943GO-bp Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial axis specification SoyBaseN/AISS
GO:0009947GO-bp Annotation by Michelle Graham. GO Biological Process: centrolateral axis specification SoyBaseN/AISS
GO:0010865GO-bp Annotation by Michelle Graham. GO Biological Process: stipule development SoyBaseN/AISS
GO:0048513GO-bp Annotation by Michelle Graham. GO Biological Process: organ development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF00046PFAM Homeobox domain JGI ISS
UniRef100_D9N1C1UniRef Annotation by Michelle Graham. Most informative UniRef hit: PRESSED FLOWER b n=1 Tax=Juncus wallichianus RepID=D9N1C1_9POAL SoyBaseE_val: 6.00E-42ISS
UniRef100_I1KJX5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJX5_SOYBN SoyBaseE_val: 9.00E-120ISS

Expression Patterns of Glyma07g15710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g15710
ParalogEvidenceComments
Glyma18g39520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g15710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g131000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g15710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g15710
>Glyma07g15710.2   sequence type=CDS   gene model=Glyma07g15710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCCCAGCAGGTTCACCAAGATGGAGCCCTACCACAGAACAGCTCATGATCTTGGAGGAACTGTACAGGAGTGGCATTAGAACTCCTAGTGCATCTCAAATTCAGCAAATTACTACACACCTTTCTTTCTATGGCAGGATAGAAGGAAAGAATGTGTTCTACTGGTTTCAGAACCACAAGGCTAGGGATAGACAGAAGCTCAGAAGGAAACTCACCAAGCAACTGCAGCTACAGCAGCAACAACAACAACAGCTCCAACTCCACCATCATTGCCCAAAACTCAATCAAGATCATTTCACTAACCATTTTGTTGGTAACTTTGGTTATAGCACTCTTCGTTCTACTACCCACGATTTTCCCTTTTTTAACCCACCTAGCTTGCTTTTTCAGGGAGGTGCTGCGAACACATCGTCAGAACAAGCATTGAGTTGCAAATGGAATGTGCATAACCCTCAAAGTAATTTGGTGGAGAGTAAAGAGATGGCATTCTGCAACTATGGTTGGACACTTGTGGATGTTGATAATAATCAAGCATCTTCATGTTGCACCACTCGACCTGTCAAGACTCTTGATCTCTTTCCTCTCACAACTACCAGAATCAGTGAAGACTGCACCACACCACCCAAGTAG
Predicted protein sequences of Glyma07g15710
>Glyma07g15710.2   sequence type=predicted peptide   gene model=Glyma07g15710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPAGSPRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARDRQKLRRKLTKQLQLQQQQQQQLQLHHHCPKLNQDHFTNHFVGNFGYSTLRSTTHDFPFFNPPSLLFQGGAANTSSEQALSCKWNVHNPQSNLVESKEMAFCNYGWTLVDVDNNQASSCCTTRPVKTLDLFPLTTTRISEDCTTPPK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo