SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g15260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g15260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g15260

Feature Type:gene_model
Chromosome:Gm07
Start:15131292
stop:15132635
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g15260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G19830AT Annotation by Michelle Graham. TAIR10: SNF7 family protein | chr2:8558101-8559389 REVERSE LENGTH=213 SoyBaseE_val: 3.00E-49ISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0000815GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ESCRT III complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1656 KOG Protein involved in glucose derepression and pre-vacuolar endosome protein sorting JGI ISS
PTHR22761Panther SNF7 - RELATED JGI ISS
PF03357PFAM Snf7 JGI ISS
UniRef100_I1KJT1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJT1_SOYBN SoyBaseE_val: 5.00E-116ISS
UniRef100_O82197UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting-associated protein 32 homolog 1 n=1 Tax=Arabidopsis thaliana RepID=VP321_ARATH SoyBaseE_val: 1.00E-46ISS

Expression Patterns of Glyma07g15260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g15260 not represented in the dataset
Glyma07g15260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g15260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g127000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g15260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g15260
>Glyma07g15260.1   sequence type=CDS   gene model=Glyma07g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGAGATGCTGGAGAAAAAAGATGATGCCAAAGAATTCGCTAAGGGAAATAACAAAAGGGCTGCGATACAATGTCTGATGAGGGAAAAGTTATATGAAAACCATATAGAGCAGCTTAGAAATTTCCAGATGCGTATTCATGACCAGATGATAATGTTGGAAGGTGCTAAAGCCACCACAAAAATGATAGATGCATTGAGAACTGGAGCAACTGCTATGAAGGCTATGCAAAAAGCAATGAAATTTGATGTTGTTGACAAGATCATGGATGAGATCAATGAACAAACTCAGAACAAGAGAATGATTCAGGAAACATTGTCAGCTCCAACTGATATTAGTAGGAATTATGATGAATTGGAAGTCGAACTTGAAGAACTAGAGGTTGTTGAGTTGGAAGAGGGGCTTCTTCAACTAACAACTACAACTCCTACAATCACATTGCAAAATGAAAAATTGTCCCATTCCTTACACTTTATGGTAGTTGAACAACTACAATGA
Predicted protein sequences of Glyma07g15260
>Glyma07g15260.1   sequence type=predicted peptide   gene model=Glyma07g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLEMLEKKDDAKEFAKGNNKRAAIQCLMREKLYENHIEQLRNFQMRIHDQMIMLEGAKATTKMIDALRTGATAMKAMQKAMKFDVVDKIMDEINEQTQNKRMIQETLSAPTDISRNYDELEVELEELEVVELEEGLLQLTTTTPTITLQNEKLSHSLHFMVVEQLQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo