SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g14551): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g14551): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g14551

Feature Type:gene_model
Chromosome:Gm07
Start:14105351
stop:14105551
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g14551
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26000AT Annotation by Michelle Graham. TAIR10: zinc finger (C3HC4-type RING finger) family protein | chr2:11082403-11085137 FORWARD LENGTH=479 SoyBaseE_val: 6.00E-20ISS
GO:0009688GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0000151GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0043130GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin binding SoyBaseN/AISS
GO:0046982GO-mf Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity SoyBaseN/AISS
PTHR24007Panther FAMILY NOT NAMED JGI ISS
UniRef100_G7IMC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Medicago truncatula RepID=G7IMC0_MEDTR SoyBaseE_val: 9.00E-22ISS
UniRef100_I1MCC9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCC9_SOYBN SoyBaseE_val: 1.00E-31ISS

Expression Patterns of Glyma07g14551
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g14551 not represented in the dataset
Glyma07g14551 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g14551 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g110100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g14551
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g14551
>Glyma07g14551.1   sequence type=CDS   gene model=Glyma07g14551   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAATCAAACGAGTTTGGGATTATGTGGGAGACAACTATGTTGATAGACTTATTCAGTCCAAAACTGATGGGATGTTGGTTGAGATGAACACTCAGTGTGCACATGCAGACAATGGATGTGGAAGTTGCAGTTGTGAAGATAATGCCATGAATGAGGCTATACTTAATAGCAAACTTGAAGCTGTAACATATGTATGA
Predicted protein sequences of Glyma07g14551
>Glyma07g14551.1   sequence type=predicted peptide   gene model=Glyma07g14551   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEIKRVWDYVGDNYVDRLIQSKTDGMLVEMNTQCAHADNGCGSCSCEDNAMNEAILNSKLEAVTYV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo