|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G14210 | AT | Annotation by Michelle Graham. TAIR10: AGAMOUS-like 44 | chr2:6018841-6023585 FORWARD LENGTH=234 | SoyBase | E_val: 2.00E-11 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0007584 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nutrient | SoyBase | N/A | ISS |
| GO:0009556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microsporogenesis | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tissue development | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
| GO:0010413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process | SoyBase | N/A | ISS |
| GO:0010638 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization | SoyBase | N/A | ISS |
| GO:0033044 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization | SoyBase | N/A | ISS |
| GO:0042546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0044036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0045492 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process | SoyBase | N/A | ISS |
| GO:0048527 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root development | SoyBase | N/A | ISS |
| GO:0048589 | GO-bp | Annotation by Michelle Graham. GO Biological Process: developmental growth | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0052543 | GO-bp | Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall | SoyBase | N/A | ISS |
| GO:0071249 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitrate | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0008134 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transcription factor binding | SoyBase | N/A | ISS |
| GO:0046983 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity | SoyBase | N/A | ISS |
| PTHR11945 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PTHR11945:SF96 | Panther | AGL21 (AGAMOUS-LIKE 21), TRANSCRIPTION FACTOR | JGI | ISS | |
| PF00319 | PFAM | SRF-type transcription factor (DNA-binding and dimerisation domain) | JGI | ISS | |
| UniRef100_G7KGG1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein n=1 Tax=Medicago truncatula RepID=G7KGG1_MEDTR | SoyBase | E_val: 1.00E-09 | ISS |
| UniRef100_I1L4U0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L4U0_SOYBN | SoyBase | E_val: 2.00E-10 | ISS |
|
Glyma07g14363 not represented in the dataset |
Glyma07g14363 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g111800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g14363.1 sequence type=CDS gene model=Glyma07g14363 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATTGATTGTCAGGTTTTGCAATTGCGTAATGATCCAAATCCTGCTGTTAGGGAAGCAGCTATTTTGTGCATTGAGGCAATTCTAACTCGTTCTTTTACTGAGAAAGACTACAAGAAAATAACAGTAGCTACAACAAGGACACTCCAAATGATCAAGAAAGCCAAAGAGCTAGCAATCCTCTGCACTGCACAAGTTGGCCTTGTCATATTCTCCTGCACGAGAAAGCTTTATGAATATGCCAGCACCAGCTTTACAAAGAGGCCTATTGAAGGAAATGCAACAATGAATTAG
>Glyma07g14363.1 sequence type=predicted peptide gene model=Glyma07g14363 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIDCQVLQLRNDPNPAVREAAILCIEAILTRSFTEKDYKKITVATTRTLQMIKKAKELAILCTAQVGLVIFSCTRKLYEYASTSFTKRPIEGNATMN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||