|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G65290 | AT | Annotation by Michelle Graham. TAIR10: LMBR1-like membrane protein | chr5:26089814-26093617 FORWARD LENGTH=548 | SoyBase | E_val: 5.00E-36 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0008284 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR21355 | Panther | UNCHARACTERIZED | JGI | ISS | |
| PF04791 | PFAM | LMBR1-like membrane protein | JGI | ISS | |
| UniRef100_G7JCR3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: LMBR1 domain-containing protein-like protein n=1 Tax=Medicago truncatula RepID=G7JCR3_MEDTR | SoyBase | E_val: 4.00E-56 | ISS |
| UniRef100_I1KR08 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KR08_SOYBN | SoyBase | E_val: 3.00E-63 | ISS |
|
Glyma07g14295 not represented in the dataset |
Glyma07g14295 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g112300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g14295.1 sequence type=CDS gene model=Glyma07g14295 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCATTTGCAATTCTATCAGCAGAGGCTATCATACTAACCAGTGGAGTTGATTTATCCCTTTTCTCTATCCTAGTACATGCTGGAGGGCAGCAAGAGGTGCTTGTACAATTGACTGCTGTCATCCCCTTAATGTATATGTGTATATGTACATATTATTCCTTGTTTAAAATGGGAATGATGATGCTTTACTCACTGACACCAAAACAGACAAGCTCAGTAAGCCTGCTTATGATATGCTCGATGATTGCAAGATATGCAGCACCCATTTCATACAACTTTCTCAATCTCATTAATCTTGGTGGGGGTAGAAAAACAATTTTTGAACAAGTATTTTACTATTCACTTCGGGTGCTTAATTTGTTGTTCTAA
>Glyma07g14295.1 sequence type=predicted peptide gene model=Glyma07g14295 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSFAILSAEAIILTSGVDLSLFSILVHAGGQQEVLVQLTAVIPLMYMCICTYYSLFKMGMMMLYSLTPKQTSSVSLLMICSMIARYAAPISYNFLNLINLGGGRKTIFEQVFYYSLRVLNLLF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||