|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G22780 | AT | Annotation by Michelle Graham. TAIR10: peroxisomal NAD-malate dehydrogenase 1 | chr2:9689995-9691923 REVERSE LENGTH=354 | SoyBase | E_val: 2.00E-73 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0006108 | GO-bp | Annotation by Michelle Graham. GO Biological Process: malate metabolic process | SoyBase | N/A | ISS |
| GO:0006635 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation | SoyBase | N/A | ISS |
| GO:0007031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: peroxisome organization | SoyBase | N/A | ISS |
| GO:0009062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process | SoyBase | N/A | ISS |
| GO:0031998 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of fatty acid beta-oxidation | SoyBase | N/A | ISS |
| GO:0044262 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0080093 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of photorespiration | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005777 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: peroxisome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016615 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: malate dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0016616 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | SoyBase | N/A | ISS |
| GO:0030060 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-malate dehydrogenase activity | SoyBase | N/A | ISS |
| PTHR11540 | Panther | MALATE AND LACTATE DEHYDROGENASE | JGI | ISS | |
| PTHR11540:SF1 | Panther | MALATE DEHYDROGENASE | JGI | ISS | |
| PF00056 | PFAM | lactate/malate dehydrogenase, NAD binding domain | JGI | ISS | |
| PF02866 | PFAM | lactate/malate dehydrogenase, alpha/beta C-terminal domain | JGI | ISS | |
| UniRef100_I1LH25 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=I1LH25_SOYBN | SoyBase | E_val: 2.00E-78 | ISS |
| UniRef100_I1LH25 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=I1LH25_SOYBN | SoyBase | E_val: 2.00E-78 | ISS |
|
Glyma07g14090 not represented in the dataset |
Glyma07g14090 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g113600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g14090.1 sequence type=CDS gene model=Glyma07g14090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTTAAGGATGCACTTATAGGCATGGACTTGGTGATCATCCCTGCAGGTGTTCCTCATAAACATGGGCTGACAAAAGATGATCTCTTCAATATAAATGTTGGAATTGTTAAAACATTGTGTGAAGCAATTGCCAAGTGTTGTCCTAAAGCCATTGTCAACGTGCTAAGCAATCCAGTTAACTCCACGGTCCTGATTACAGCCGAAGTTTTCAAAAGAGTTGGTACTTACGATCCCAAGAGACTTTTGGGAGTCACTATGCTCGATGTTGTTAGAGCCAATATGTTTGTGGCAGAAGTTCTGGGTGTTGATCTAAGGTATGTGGATGTCCCAATCATTGGGGGACATGTTGGAATCACAATTTTACCTCTTCTTTCTCAGATTAAACCTCCTTGCTCTTTCACCCTAAAAAGAAGTGAGTACCCTTCCTCAACAATATTAACT
>Glyma07g14090.1 sequence type=predicted peptide gene model=Glyma07g14090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LKDALIGMDLVIIPAGVPHKHGLTKDDLFNINVGIVKTLCEAIAKCCPKAIVNVLSNPVNSTVLITAEVFKRVGTYDPKRLLGVTMLDVVRANMFVAEVLGVDLRYVDVPIIGGHVGITILPLLSQIKPPCSFTLKRSEYPSSTILT
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||