Glyma07g13585 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g13585): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g13585): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g13585

Feature Type:	gene_model
Chromosome:	Gm07
Start:	12513415
stop:	12515338
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g13585

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14710	AT	Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein \| chr4:8424943-8426360 REVERSE LENGTH=182	SoyBase	E_val: 7.00E-57	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0010309	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acireductone dioxygenase [iron(II)-requiring] activity	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
KOG2107	KOG	Uncharacterized conserved protein, contains double-stranded beta-helix domain	JGI		ISS
PTHR23418	Panther	ACIREDUCTONE DIOXYGENASE	JGI		ISS
PF03079	PFAM	ARD/ARD' family	JGI		ISS
UniRef100_F6HDT7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 n=1 Tax=Vitis vinifera RepID=MTND2_VITVI	SoyBase	E_val: 1.00E-55	ISS
UniRef100_UPI0002337F20	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337F20 related cluster n=1 Tax=unknown RepID=UPI0002337F20	SoyBase	E_val: 2.00E-89	ISS

Expression Patterns of Glyma07g13585

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g13585 not represented in the dataset	Glyma07g13585 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g13585 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g116400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g13585

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g13585

Limit To All Plant Sequences

>Glyma07g13585.1   sequence type=CDS   gene model=Glyma07g13585   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCGACATCTGCCATTAATAACATTGGATGATAGTGATGAAGATCAAACACTCCCCCACCACAAAGCACCTAAGGAGTTTGTCTCGTTGGACCAACTTGTTGAACTTGGAGTCCTTAGTTGGAAACTAGATGCTGATAACCATGGAAATGATCCAGAGCTGAAGAAGATTCATGAAGAGCATGGTTACACCTACATGCATTTTCACACTGATGAGGAGATCCTCTTTTGTGCTGCTGGAAGCCGCTATTGTGATGTTAAGGATCACAATGATGCTTGGATTCGTGAGTGGGTCAAGAAAGGAGGAATGATCATCTTACCTGTCAGAATTTATCATCACTTTACGCTAGATGAGAGCAACTACATTAAGGCTTTGCATTTTTTTGTTGGTGAGCCAGTTTAG

Predicted protein sequences of Glyma07g13585

Limit To All Plant Sequences

>Glyma07g13585.1   sequence type=predicted peptide   gene model=Glyma07g13585   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNRHLPLITLDDSDEDQTLPHHKAPKEFVSLDQLVELGVLSWKLDADNHGNDPELKKIHEEHGYTYMHFHTDEEILFCAAGSRYCDVKDHNDAWIREWVKKGGMIILPVRIYHHFTLDESNYIKALHFFVGEPV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain