|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G06990 | AT | Annotation by Michelle Graham. TAIR10: RNA helicase, ATP-dependent, SK12/DOB1 protein | chr2:2895135-2900909 FORWARD LENGTH=995 | SoyBase | E_val: 8.00E-36 | ISS |
| GO:0000085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0000398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome | SoyBase | N/A | ISS |
| GO:0003002 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regionalization | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006396 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA processing | SoyBase | N/A | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010093 | GO-bp | Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0016070 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA metabolic process | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0016571 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone methylation | SoyBase | N/A | ISS |
| GO:0016579 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein deubiquitination | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0022402 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell cycle process | SoyBase | N/A | ISS |
| GO:0030422 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in RNA interference | SoyBase | N/A | ISS |
| GO:0033043 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of organelle organization | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0043687 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-translational protein modification | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048449 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral organ formation | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003724 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA helicase activity | SoyBase | N/A | ISS |
| GO:0004386 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: helicase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008026 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity | SoyBase | N/A | ISS |
| GO:0016817 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides | SoyBase | N/A | ISS |
| GO:0016818 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | SoyBase | N/A | ISS |
| PF08148 | PFAM | DSHCT (NUC185) domain | JGI | ISS | |
| UniRef100_G7LIV7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent RNA helicase DOB1 n=1 Tax=Medicago truncatula RepID=G7LIV7_MEDTR | SoyBase | E_val: 2.00E-39 | ISS |
| UniRef100_I1KPQ5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPQ5_SOYBN | SoyBase | E_val: 1.00E-40 | ISS |
|
Glyma07g12800 not represented in the dataset |
Glyma07g12800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g121400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g12800.1 sequence type=CDS gene model=Glyma07g12800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACGTACGAGACTCAGAAATAGTTGAACTATTGAATCAAGTTGAGGAACTTGAGAAAAAATTGTTTGCTCATCCTATGCATAAGATTCGATTATTAAGCCAAATCAAGTCTTGGAAGTTTGGAACTGAATATGAGTTTGTCTTAAAGAAGCTTGGTCATACTGATGCTGATGGTGTAGTTCAGTTGAGGGGACGAGCAGCCTGCTTGATTGACACAGGCGATGAACTCCTTGTCATCGAATTAATGTTTAATGGTGAATCAATATTTGTTTCCCTATTGTGCTTTCTATATAGTTTGCAGTTCATTATTTTTGAATACCTACCTAAGTTGCTGCCCTTGCAAATACAACTGAGAACAGAGCTTGCAAGGCCTCTGCAACAGATTCAAGATAGTGTAAGAAGGATAGCTGAGATATTTAAGTCACTTACTTGGCCTCTTGCATTAAGGAGTATGTTAGAAATATATTATATAAAAACCATTCACGGGTCTTCACCCAATAGCTTGAGCTTTTGGATTGATGATTCATGA
>Glyma07g12800.1 sequence type=predicted peptide gene model=Glyma07g12800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDVRDSEIVELLNQVEELEKKLFAHPMHKIRLLSQIKSWKFGTEYEFVLKKLGHTDADGVVQLRGRAACLIDTGDELLVIELMFNGESIFVSLLCFLYSLQFIIFEYLPKLLPLQIQLRTELARPLQQIQDSVRRIAEIFKSLTWPLALRSMLEIYYIKTIHGSSPNSLSFWIDDS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||