SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g12630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g12630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g12630

Feature Type:gene_model
Chromosome:Gm07
Start:11002835
stop:11003423
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATMG00220AT Annotation by Michelle Graham. TAIR10: apocytochrome b | chrM:60235-61416 FORWARD LENGTH=393 SoyBaseE_val: 3.00E-99ISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0022904GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory electron transport chain SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005750GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008121GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR19271Panther CYTOCHROME B JGI ISS
PF00032PFAM Cytochrome b(C-terminal)/b6/petD JGI ISS
UniRef100_H8Y6Q3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b n=3 Tax=Glycine max RepID=H8Y6Q3_SOYBN SoyBaseE_val: 4.00E-103ISS
UniRef100_UPI0002337D9FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337D9F related cluster n=1 Tax=unknown RepID=UPI0002337D9F SoyBaseE_val: 3.00E-119ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g12630 not represented in the dataset

Glyma07g12630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g122200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g12630.2   sequence type=CDS   gene model=Glyma07g12630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCAAATTTCTTTTTACCCTTATTTTTATGTAAAGGATCTAGTAGGTTGGGTAGCTTTTGCTATCTTTTTTTCCATTTGGATTTTTTATGCTCCTAATGTTTTGGGCCATCCCGACAATTATATACCTGCTAATCTGATGCCCACCCCACCTCATATTGTGTCGGAATGGTATTTCCTACTGATCCATGCCATTCTTCGTAGTATACTTGACAAATCGGGAGGTGTAGCCCCAATAGCACCAGTTTTTATATGTGTGTTGGCTTTACCTTTTTTTAAAAGTATGTACGTGCGCAGTTCAAGTTTTCGCCCTATTCACCAAGGAATATTTTGGTTGCTTTTGGCGGATCGCTTACTACTAGGTTGGATCGGATGTCAACCTGTGGAGGCACCTTTTGTTACTATTGGACAAATTCCTCCTTTTGTTTTCTTCTTGTTCTTTGCCATAACGCCCATTCCGGGACGAGTTGGAAGAGGAATTCCGAATTCTTACACGGATGAGACTGATCAGTGA

>Glyma07g12630.2   sequence type=predicted peptide   gene model=Glyma07g12630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNQISFYPYFYVKDLVGWVAFAIFFSIWIFYAPNVLGHPDNYIPANLMPTPPHIVSEWYFLLIHAILRSILDKSGGVAPIAPVFICVLALPFFKSMYVRSSSFRPIHQGIFWLLLADRLLLGWIGCQPVEAPFVTIGQIPPFVFFLFFAITPIPGRVGRGIPNSYTDETDQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo