SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g11980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g11980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g11980

Feature Type:gene_model
Chromosome:Gm07
Start:10259913
stop:10263660
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g11980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73820AT Annotation by Michelle Graham. TAIR10: Ssu72-like family protein | chr1:27755740-27757158 REVERSE LENGTH=193 SoyBaseE_val: 2.00E-116ISS
GO:0006397GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA processing SoyBaseN/AISS
GO:0006470GO-bp Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004721GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity SoyBaseN/AISS
KOG2424 KOG Protein involved in transcription start site selection JGI ISS
PTHR20383Panther FAMILY NOT NAMED JGI ISS
PF04722PFAM Ssu72-like protein JGI ISS
UniRef100_B9RPG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein SSU72, putative n=1 Tax=Ricinus communis RepID=B9RPG0_RICCO SoyBaseE_val: 1.00E-125ISS
UniRef100_C6SZ62UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ62_SOYBN SoyBaseE_val: 6.00E-142ISS

Expression Patterns of Glyma07g11980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g11980 not represented in the dataset
Glyma07g11980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g11980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g106200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g11980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g11980
>Glyma07g11980.1   sequence type=CDS   gene model=Glyma07g11980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTTTCGGTACGCGATGGTGTGTTCTTCGAACCAGAACCGAAGCATGGAGGCTCATTTCCTGCTCAAGAGGCAGGGCTTCGACGTGTCCTCGTACGGCACCGGTGCCCACGTTAAGCTCCCTGGTCCTTCCCTCAGAGAACCCAATGTCTACGACTTCGGAACCCCCTACAAGCACATGATCGAGGACCTCCGCAGAAAAGACCCCGATCTCTACAAACGAAACGGAATCTTTCCAATGCTTAAAAGAAATTCAACAGTCAAATTAGCACCGCAACGGTGGCAAGAAAATGCCGCTGATGGTTCCTTTGATGTGGTAGTTACATTTGAAGAAAAAGTGTTTGATATGGTTATTGAAGATCTCCATAATAGAGATCATGCTTTATTGAAAACTGTGCTGGTAATCAACTTGGAGGTAAAAGATAACCACGATGAAGCAGCCGTGGGAGCAAGGCTTACTTTAGATCTCTGTCGGGAGATTGAAGCTGCTGAATCATGGGAAGAGTCAATTGATGAAATTATTGCTGGTTTTGAGAATAAACATCGGCGGAAGCTTTTGTACAGCATCTCCTTCTACTAA
Predicted protein sequences of Glyma07g11980
>Glyma07g11980.1   sequence type=predicted peptide   gene model=Glyma07g11980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFRYAMVCSSNQNRSMEAHFLLKRQGFDVSSYGTGAHVKLPGPSLREPNVYDFGTPYKHMIEDLRRKDPDLYKRNGIFPMLKRNSTVKLAPQRWQENAADGSFDVVVTFEEKVFDMVIEDLHNRDHALLKTVLVINLEVKDNHDEAAVGARLTLDLCREIEAAESWEESIDEIIAGFENKHRRKLLYSISFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo