|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G35980 | AT | Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr2:15110635-15111318 FORWARD LENGTH=227 | SoyBase | E_val: 1.00E-26 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0002679 | GO-bp | Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf senescence | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0051607 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to virus | SoyBase | N/A | ISS |
| GO:0051707 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to other organism | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR19957 | Panther | SYNTAXIN | JGI | ISS | |
| PTHR19957:SF11 | Panther | SYNTAXIN-RELATED | JGI | ISS | |
| UniRef100_G7KQ92 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Harpin inducing protein n=1 Tax=Medicago truncatula RepID=G7KQ92_MEDTR | SoyBase | E_val: 5.00E-44 | ISS |
| UniRef100_I1KJ74 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KJ74_SOYBN | SoyBase | E_val: 6.00E-71 | ISS |
|
Glyma07g11740 not represented in the dataset |
Glyma07g11740 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g104000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g11740.2 sequence type=CDS gene model=Glyma07g11740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTGTATATCATGCTTCCCTCAATCCTCTTCTGGTTAATCATCTTCCCCTCAAGTTGCAAGTTCCATGTAACTGATGCCTCCCTCACACAATTCAACCTCAGAAGCAACAACACCTTGGACTACAACTTGAAGGTCAGCATCACAGTGAGAAACCCCAACAACAACATCATAGTGTACTATGGTAGGATCACATCAATAGCTTGGTACAAAGATAATGATTTCAGTTGGGTGAGCTTAACACCCTTTGGCCAATGCCGCAAGAATACCACCTTCCTTCAAGCAGTGTTTGAAGGGAAAAGTGTGATTAAGCACAAATCAAAAGAACTTGGTGAGTATAAAGATGAGACAAGTGTTGGAATTTAG
>Glyma07g11740.2 sequence type=predicted peptide gene model=Glyma07g11740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLYIMLPSILFWLIIFPSSCKFHVTDASLTQFNLRSNNTLDYNLKVSITVRNPNNNIIVYYGRITSIAWYKDNDFSWVSLTPFGQCRKNTTFLQAVFEGKSVIKHKSKELGEYKDETSVGI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||